Return to main results Retrieve Phyre Job Id

Job DescriptionP75979
Confidence2.99%DateThu Jan 5 12:16:51 GMT 2012
Rank21Aligned Residues27
% Identity33%Templated1ciya3
SCOP infoToxins' membrane translocation domains delta-Endotoxin (insectocide), N-terminal domain delta-Endotoxin (insectocide), N-terminal domain
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.
Predicted Secondary structure 

Query SS confidence 
































Query Sequence  LVGVLGALLLAYGAWLIYPPAGFVVAGALCLFW
Query Conservation 








 
 




















Alig confidence 











.....







.






Template Conservation     
    
   .....

  
 
 . 

  

Template Sequence  SLSLTQFLLSEF. . . . . VPGAGFVL. GLVDIIW
Template Known Secondary structure 

.....SSS.TT
Template Predicted Secondary structure 
.....


.
Template SS confidence 
































   3940.........50 ........ .60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions