Return to main results Retrieve Phyre Job Id

Job DescriptionP75979
Confidence3.52%DateThu Jan 5 12:16:51 GMT 2012
Rank16Aligned Residues25
% Identity28%Templatec1p4eB_
PDB info PDB header:dna binding protein/recombination/dnaChain: B: PDB Molecule:recombinase flp protein; PDBTitle: flpe w330f mutant-dna holliday junction complex
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.......
Predicted Secondary structure 

Query SS confidence 





























Query Sequence  LAYGAWLIYPPAGFVVAGALCLFWSWLVAR
Query Conservation   
 


























Alig confidence 





.....


















Template Conservation    

 
.....  


 


 

  
   
Template Sequence  IRYPAW. . . . . NGIISQEVLDYLSSYINRR
Template Known Secondary structure 
GGG.....TTTS
Template Predicted Secondary structure 


.....
Template SS confidence 





























   398.400... ......410.........420..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions