Return to main results Retrieve Phyre Job Id

Job DescriptionQ46941
Confidence65.94%DateThu Jan 5 12:36:00 GMT 2012
Rank454Aligned Residues38
% Identity8%Templatec3fymA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: the 1a structure of ymfm, a putative dna-binding membrane2 protein from staphylococcus aureus
Resolution1.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   165....170.........180..... ....190.........200..
Predicted Secondary structure 






.................


Query SS confidence 




















. . . . . . . . . . . . . . . . .
















Query Sequence  SGYNPYQIAEVLDMDIRSIYA. . . . . . . . . . . . . . . . . YKQRIEKRMGGKINELF
Query Conservation   
 
  


  
 

  

  .................
   
  


     
 
Alig confidence 




















.................
















Template Conservation   


   

    

   
  

 
              
   
  


    

Template Sequence  LGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSEGFIRKYASVVNIEPNQLI
Template Known Secondary structure  TT




TT
GGGSSSGGGTT

Template Predicted Secondary structure 


















Template SS confidence 






















































   1015....1020.........1030.........1040.........1050.........1060.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions