Return to main results Retrieve Phyre Job Id

Job DescriptionP10905
Confidence1.34%DateWed Jan 25 15:20:37 GMT 2012
Rank84Aligned Residues32
% Identity25%Templated1mg7a1
SCOP infoRibosomal protein S5 domain 2-like Ribosomal protein S5 domain 2-like Early switch protein XOL-1, N-terminal domain
Resolution1.55

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   31........40.........50.........60.........70.......
Predicted Secondary structure 
















Query SS confidence 














































Query Sequence  WPAGEALWYSLQSVDPFGFSSQFVGLDNFVTLFHDSYYLDSFWTTIK
Query Conservation   

   
  

              
               
 


 
Alig confidence 









...............





















Template Conservation    

 




...............
   
    
    


  
  
Template Sequence  IPMLIALWKC. . . . . . . . . . . . . . . MLASETDICDQEVLKSIMNSVI
Template Known Secondary structure  ...............TTSTT


Template Predicted Secondary structure  ...............



Template SS confidence 














































   134.....140... ......150.........160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions