Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H1
Confidence96.17%DateThu Jan 5 11:03:08 GMT 2012
Rank302Aligned Residues40
% Identity35%Templatec3h1tA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:type i site-specific restriction-modification PDBTitle: the fragment structure of a putative hsdr subunit of a type2 i restriction enzyme from vibrio vulnificus yj016
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   81........90.........100.........110.........120.........130......
Predicted Secondary structure 

















Query SS confidence 























































Query Sequence  QEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLARLL
Query Conservation 
  
       
                       
  
  
 


  
   
   
Alig confidence 











................



























Template Conservation 
  

  
    ................    
  

   





     
   
Template Sequence  QQIAINRAVQSV. . . . . . . . . . . . . . . . LQGKKRSLITXATGTGKTVVAFQISWKL
Template Known Secondary structure  ................TT
S
TTS
Template Predicted Secondary structure  ................









Template SS confidence 























































   183......190.... .....200.........210.........220..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions