Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6H1
Confidence94.38%DateThu Jan 5 11:03:08 GMT 2012
Rank465Aligned Residues52
% Identity15%Templatec1xtkA_
PDB info PDB header:gene regulationChain: A: PDB Molecule:probable atp-dependent rna helicase p47; PDBTitle: structure of decd to dead mutation of human uap56
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   61........70.........80 .........90.........100.........110.........120.........130...
Predicted Secondary structure 






.....

















Query SS confidence 



















. . . . .




















































Query Sequence  RSALPTPHEIRNHLDDYVIG. . . . . QEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLA
Query Conservation           
   
   


.....
  
       
                       
  
  
 


  
   
Alig confidence 



















.....








.....................






















Template Conservation 
  
 
   
   
   
       
  

  

.....................    


 








   
 
Template Sequence  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI. . . . . . . . . . . . . . . . . . . . . LGMDVLCQAKSGMGKTAVFVLAT
Template Known Secondary structure  GGGG


TT




.....................TT



SSTT
Template Predicted Secondary structure 











.....................









Template SS confidence 













































































   47..50.........60.........70.........80 .........90.........100...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions