Return to main results Retrieve Phyre Job Id

Job DescriptionP76335
Confidence96.50%DateThu Jan 5 12:21:55 GMT 2012
Rank30Aligned Residues66
% Identity18%Templatec3aehB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:hemoglobin-binding protease hbp autotransporter; PDBTitle: integral membrane domain of autotransporter hbp
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   308.310.........320.........330.........340.........350.........360.........370.........380.......
Predicted Secondary structure 














































Query SS confidence 















































































Query Sequence  FDFGLRPSIAYLQSKGKDLGGWAHDGNGDPRYTNKDLVKYVDIGATYYFNKNMSTYVDYKINLLDNDDDFYEANGIATDD
Query Conservation            
                                
  
 


 
 

 

                     
Alig confidence 
























...............



























.........


Template Conservation              
            ...............  

          
        
    .........   
Template Sequence  WSLTARAGLHYEFDLTDSRKDSRML. . . . . . . . . . . . . . . YGVGLNARFGDNTRLGLEVERSAFGKYN. . . . . . . . . TDD
Template Known Secondary structure  S


...............TTTS
SS.........
Template Predicted Secondary structure 








...............







.........
Template SS confidence 















































































   1296...1300.........1310.........1320 .........1330.........1340........ .1350.
 
   388.390.......
Predicted Secondary structure 
Query SS confidence 









Query Sequence  IVAVGLVYQF
Query Conservation      
 
  
Alig confidence 









Template Conservation      



 
Template Sequence  AINANIRYSF
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 









   1368.1370.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions