Return to main results Retrieve Phyre Job Id

Job DescriptionP09053
Confidence23.95%DateThu Jan 5 11:01:50 GMT 2012
Rank365Aligned Residues51
% Identity14%Templatec1pklB_
PDB info PDB header:transferaseChain: B: PDB Molecule:protein (pyruvate kinase); PDBTitle: the structure of leishmania pyruvate kinase
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   341........350.........360.........370.........380.........390... ......400.........410..
Predicted Secondary structure 


























.
Query SS confidence 




















































.


















Query Sequence  LWLWFKDLPITTKQLYQRLKARGVLMVPGHNFFPGLDKPWPHTHQCMRMNYVP. EPEKIEAGVKILAEEIERA
Query Conservation      
         
   
   

 
 

  
              



   .  
 
  

 

  

   
Alig confidence 




.



















....................






.


















Template Conservation 

 

.



   
 
  

 

  
.................... 


 


  
     
  

      
Template Sequence  IICTI. GPSTQSVEALKGLIQSGMSV. . . . . . . . . . . . . . . . . . . . ARMNFSHGSHEYHQTTINNVRQAAAEL
Template Known Secondary structure 
.
TTT
ST....................TTSS
Template Predicted Secondary structure 
.









....................




Template SS confidence 








































































   23.... ..30.........40....... ..50.........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions