Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACB7
Confidence84.27%DateThu Jan 5 11:17:50 GMT 2012
Rank120Aligned Residues41
% Identity20%Templatec2dl1A_
PDB info PDB header:protein transportChain: A: PDB Molecule:spartin; PDBTitle: solution structure of the mit domain from human spartin
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   335....340.........350.........360.........370.........380.........
Predicted Secondary structure 








Query SS confidence 






















































Query Sequence  GQSLMKHGEWQEASLAFRAALKQRPDAYDYAWLADALDRLHKPEEAAAMRRDGLM
Query Conservation 
      
    
   
  

   
       

      
    
     


 
Alig confidence 
























..............















Template Conservation 
 
  

     

  
  

  

.............. 
 
  

  

 

 
Template Sequence  AEIKIIREAYKKAFLFVNKGLNTDE. . . . . . . . . . . . . . LGQKEEAKNYYKQGIG
Template Known Secondary structure  S..............T
Template Predicted Secondary structure  ..............


Template SS confidence 






















































   10.........20.........30.... .....40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions