Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8S5
Confidence18.00%DateThu Jan 5 11:08:37 GMT 2012
Rank7Aligned Residues27
% Identity33%Templated1rh5b_
SCOP infoSingle transmembrane helix Preprotein translocase SecE subunit Preprotein translocase SecE subunit
Resolution3.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   78.80...... ...90.........100....
Predicted Secondary structure  ........
Query SS confidence 








. . . . . . . .

















Query Sequence  EFIRRCERV. . . . . . . . RRQFILTSALCGLVVVSL
Query Conservation   

 

 

........
  




 
 
      
Alig confidence 








........

















Template Conservation   

 
  



 




 


  





 

 

Template Sequence  EFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLL
Template Known Secondary structure  S




Template Predicted Secondary structure 



Template SS confidence 


































   13......20.........30.........40.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions