Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACF8
Confidence8.66%DateThu Jan 5 11:18:05 GMT 2012
Rank46Aligned Residues40
% Identity20%Templated1iqpa1
SCOP infopost-AAA+ oligomerization domain-like post-AAA+ oligomerization domain-like DNA polymerase III clamp loader subunits, C-terminal domain
Resolution2.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60.........70.......
Predicted Secondary structure 




Query SS confidence 























































Query Sequence  TLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLN
Query Conservation 
  

  
   
   
 
             

   
  
       


  

  
Alig confidence 













................

























Template Conservation   
 

  

   
 ................     
   
  
    
 
  


 
Template Sequence  RPEDIREMMLLALK. . . . . . . . . . . . . . . . GNFLKAREKLREILLKQGLSGEDVLV
Template Known Secondary structure 
................T



Template Predicted Secondary structure 
................





Template SS confidence 























































   235....240........ .250.........260.........270....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions