Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACF8
Confidence9.29%DateThu Jan 5 11:18:05 GMT 2012
Rank43Aligned Residues43
% Identity30%Templatec2rpbA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:hypothetical membrane protein; PDBTitle: the solution structure of membrane protein
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70.....
Predicted Secondary structure 





Query SS confidence 






























































Query Sequence  TLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNEL
Query Conservation   

   
 

  

  
   
   
 
             

   
  
       


  

Alig confidence 


























....................















Template Conservation   

  
      
    
  
   
  .................... 
   
   

 
  
Template Sequence  NLRAIIGEMELDETLSGRDIINARLRE. . . . . . . . . . . . . . . . . . . . ELDKITDRWGVKITRV
Template Known Secondary structure  TS

TT
....................GGGT


Template Predicted Secondary structure 



....................


Template SS confidence 






























































   122.......130.........140........ .150.........160....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions