Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACF8
Confidence9.28%DateThu Jan 5 11:18:05 GMT 2012
Rank44Aligned Residues55
% Identity25%Templatec1o17A_
PDB info PDB header:transferaseChain: A: PDB Molecule:anthranilate phosphoribosyltransferase; PDBTitle: anthranilate phosphoribosyl-transferase (trpd)
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70.......
Predicted Secondary structure 






Query SS confidence 












































































Query Sequence  MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLN
Query Conservation 


    
   
 

   
 

  

  
   
   
 
             

   
  
       


  

  
Alig confidence 










.......
















...............


























Template Conservation      
     
.......  

 


      

 ...............
   
 
  


 


 



  

 
Template Sequence  INEILKKLINK. . . . . . . SDLEINEAEELAKAIIR. . . . . . . . . . . . . . . GEVPEILVSAILVALRMKGESKNEIVG
Template Known Secondary structure  TT.......



T...............T
S



Template Predicted Secondary structure 

.......




...............







Template SS confidence 












































































   3......10... ......20.........30 .........40.........50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions