Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF88
Confidence89.32%DateThu Jan 5 11:31:46 GMT 2012
Rank129Aligned Residues55
% Identity13%Templatec3f6wE_
PDB info PDB header:dna binding proteinChain: E: PDB Molecule:xre-family like protein; PDBTitle: xre-family like protein from pseudomonas syringae pv. tomato str.2 dc3000
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  LWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREV
Query Conservation      
      
   

       
                  

  

  
  
   
 
 
 

  

   


 


Alig confidence 

























..








.......................



















Template Conservation 
   



  

   


 
 

  
.. 
       ....................... 
  

  
 
    

   
Template Sequence  RSAAGITQKELAARLGRPQSFVSKTE. . NAERRLDVI. . . . . . . . . . . . . . . . . . . . . . . EFXDFCRGIGTDPYALLSKL
Template Known Secondary structure  T

TS
..TTSS


.......................TTT

Template Predicted Secondary structure 






..






.......................


Template SS confidence 















































































   20.........30.........40..... ....50.... .....60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions