Return to main results Retrieve Phyre Job Id

Job DescriptionP07639
Confidence59.10%DateThu Jan 5 11:00:23 GMT 2012
Rank133Aligned Residues29
% Identity21%Templatec3hbmA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:udp-sugar hydrolase; PDBTitle: crystal structure of pseg from campylobacter jejuni
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   95....100.........110.........120.........130
Predicted Secondary structure 












Query SS confidence 



































Query Sequence  RDTTLVALGGGVVGDLTGFAAASYQRGVRFIQVPTT
Query Conservation    
 










 

  
     
 
 
 



Alig confidence 















.......












Template Conservation   

 

  

 
  

.......
  
 
 
 

  
Template Sequence  ESNKLIISASSLVNEA. . . . . . . LLLKANFKAICYV
Template Known Secondary structure  TSS.......TT



S
Template Predicted Secondary structure 



.......




Template SS confidence 



































   225....230.........240 .........250...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions