Return to main results Retrieve Phyre Job Id

Job DescriptionP00370
Confidence93.36%DateThu Jan 5 10:56:35 GMT 2012
Rank410Aligned Residues67
% Identity9%Templatec3ktdC_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:prephenate dehydrogenase; PDBTitle: crystal structure of a putative prephenate dehydrogenase (cgl0226)2 from corynebacterium glutamicum atcc 13032 at 2.60 a resolution
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   233......240.........250.........260.........270.........280.........290.........300.........310..
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  MRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWS
Query Conservation    




 



   
  
   








  
 



 


   
                     
   
     
 
Alig confidence 


























.


..........





















...........





Template Conservation 
 
 


 



 


 

   
  
 .  
..........
       
   
         ...........      
Template Sequence  RPVCILGLGLIGGSLLRDLHAANHSVF. GYN. . . . . . . . . . RSRSGAKSAVDEGFDVSADLEA. . . . . . . . . . . TLQRAA
Template Known Secondary structure  S


STT

.
..........SSTT

S
...........
Template Predicted Secondary structure 






...........












...........
Template SS confidence 















































































   8.10.........20.........30.... ... ..40.........50......... 60.....
 
   313......320.
Predicted Secondary structure 




Query SS confidence 








Query Sequence  LPVDIALPC
Query Conservation     





Alig confidence 








Template Conservation     





Template Sequence  AEDALIVLA
Template Known Secondary structure  TT

Template Predicted Secondary structure 




Template SS confidence 








   66...70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions