Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionA1A4G5
DateWed May 9 17:41:39 BST 2012
Unique Job ID1c0305709ee8af1f

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2d7gD_
Top template information
PDB header:hydrolase
Chain: D: PDB Molecule:primosomal protein n;
PDBTitle: crystal structure of the aa complex of the n-terminal2 domain of pria
Confidence and coverage
Confidence: 52.4% Coverage: 12%
21 residues ( 12% of your sequence) have been modelled with 52.4% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
Warning: 57% of your sequence is predicted disordered. Disordered regions cannot be meaningfully predicted.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MEHKDDDDDDVSFAKWMSSFWGHSWREEDQRGLRERHRLQATSHRKTSLPCPLPVLPRIP
Secondary structure 





















SS confidence 



























































Disorder  ??????????















???














????





?????
Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.........120
Sequence  SSDCHPRRHSHEDQEFRCRSHVRDYRKYSEDGSFKEPLESKGRSHSKIEKFSESFERQLC
Secondary structure 

















SS confidence 



























































Disorder  ????????????????

?

???????????????????????
??












Disorder confidence 



























































 
   .........130.........140.........150.........160.........170........
Sequence  FRTKRSASLGPESRKERNERECLRMEIKSRKKVEEERSSRKEEHGEAHMAPLFEKGPE
Secondary structure 







SS confidence 

























































Disorder 


????????







?


???????????????????????






?????
Disorder confidence 

























































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 2d7g chain D

3D model

Region: 7 - 27
Aligned: 21
Modelled: 21
Confidence: 52.4%
Identity: 10%
PDB header:hydrolase
Chain: D: PDB Molecule:primosomal protein n;
PDBTitle: crystal structure of the aa complex of the n-terminal2 domain of pria

Phyre2
1

c2d7gD_



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c2d7gD_



52.4 10 PDB header:hydrolase
Chain: D: PDB Molecule:primosomal protein n;
PDBTitle: crystal structure of the aa complex of the n-terminal2 domain of pria

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite