Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionC6Y4B0
DateSun Jul 8 11:45:06 BST 2012
Unique Job ID33a25918338427a6

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2diuA_
Top template information
PDB header:rna binding protein
Chain: A: PDB Molecule:kiaa0430 protein;
PDBTitle: solution structure of the rrm domain of kiaa0430 protein
Confidence and coverage
Confidence: 42.3% Coverage: 56%
19 residues ( 56% of your sequence) have been modelled with 42.3% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30....
Sequence  MRLRRLFKQPSTRVLGVTNCPRQQGHQKRREQPD
Secondary structure 













SS confidence 

































Disorder  ??



?













?

??



????
Disorder confidence 

































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 2diu chain A

3D model

Region: 2 - 20
Aligned: 19
Modelled: 19
Confidence: 42.3%
Identity: 47%
PDB header:rna binding protein
Chain: A: PDB Molecule:kiaa0430 protein;
PDBTitle: solution structure of the rrm domain of kiaa0430 protein

Phyre2

PDB 2r4q chain A domain 1

3D model

Region: 13 - 21
Aligned: 9
Modelled: 9
Confidence: 12.4%
Identity: 56%
Fold: Phosphotyrosine protein phosphatases I-like
Superfamily: PTS system IIB component-like
Family: PTS system, Fructose specific IIB subunit-like

Phyre2
1

c2diuA_
2

d2r4qa1



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c2diuA_



42.3 47 PDB header:rna binding protein
Chain: A: PDB Molecule:kiaa0430 protein;
PDBTitle: solution structure of the rrm domain of kiaa0430 protein
2d2r4qa1



12.4 56 Fold:Phosphotyrosine protein phosphatases I-like
Superfamily:PTS system IIB component-like
Family:PTS system, Fructose specific IIB subunit-like

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite