Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionO13512
DateMon Jul 2 19:10:05 BST 2012
Unique Job ID98f31f3b2ea06c14

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c2zw3B_
Top template information
PDB header:cell adhesion
Chain: B: PDB Molecule:gap junction beta-2 protein;
PDBTitle: structure of the connexin-26 gap junction channel at 3.52 angstrom resolution
Confidence and coverage
Confidence: 13.1% Coverage: 19%
24 residues ( 19% of your sequence) have been modelled with 13.1% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLIDTMAGEAVLEH
Secondary structure 





SS confidence 



























































Disorder  ??????????
















































?
Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.........120
Sequence  TSDSQEEIVTTVVCSVVPLVCFVVSVVCFVISVVEIGHHVVYSVVAPLTVTVAVETIAEE
Secondary structure 
SS confidence 



























































Disorder 



























































Disorder confidence 



























































 
   ......
Sequence  MDSVHT
Secondary structure 

SS confidence 





Disorder 

????
Disorder confidence 





 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite