BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (73 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobac... 156 2e-37 UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfa... 54 2e-06 >UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobacteriaceae RepID=YEET_ECO57 Length = 73 Score = 156 bits (394), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%) Query: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS Sbjct: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 Query: 61 FGPYVRLMSVTLN 73 FGPYVRLMSVTLN Sbjct: 61 FGPYVRLMSVTLN 73 >UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfatibacillum alkenivorans AK-01 RepID=B8FNH6_DESAA Length = 81 Score = 53.5 bits (127), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 15/79 (18%) Query: 1 MKIITRGEAMRIHQQH----------PTSRLFPFCTGKYRWHGSAEAYTGREVQDI-PGV 49 MKI+T+ +A+ + + PT + +GKY+W G A YTG ++ + P + Sbjct: 1 MKIVTKKDAVELASKTILDGKNRAKTPTK----YDSGKYKWTGKASDYTGVDIDFVWPEL 56 Query: 50 LAVFAERRKDSFGPYVRLM 68 LAV+ ERR D+ GPY +LM Sbjct: 57 LAVYVERRSDANGPYAQLM 75 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobac... 141 1e-32 UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfa... 99 4e-20 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P64523 Uncharacterized protein yeeT n=144 Tax=Enterobacteriaceae RepID=YEET_ECO57 Length = 73 Score = 141 bits (354), Expect = 1e-32, Method: Composition-based stats. Identities = 73/73 (100%), Positives = 73/73 (100%) Query: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS Sbjct: 1 MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDS 60 Query: 61 FGPYVRLMSVTLN 73 FGPYVRLMSVTLN Sbjct: 61 FGPYVRLMSVTLN 73 >UniRef50_B8FNH6 Putative uncharacterized protein n=1 Tax=Desulfatibacillum alkenivorans AK-01 RepID=B8FNH6_DESAA Length = 81 Score = 99.0 bits (245), Expect = 4e-20, Method: Composition-based stats. Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 7/75 (9%) Query: 1 MKIITRGEAMRIHQQH------PTSRLFPFCTGKYRWHGSAEAYTGREVQDI-PGVLAVF 53 MKI+T+ +A+ + + + +GKY+W G A YTG ++ + P +LAV+ Sbjct: 1 MKIVTKKDAVELASKTILDGKNRAKTPTKYDSGKYKWTGKASDYTGVDIDFVWPELLAVY 60 Query: 54 AERRKDSFGPYVRLM 68 ERR D+ GPY +LM Sbjct: 61 VERRSDANGPYAQLM 75 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.311 0.131 0.376 Lambda K H 0.267 0.0386 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 258,023,748 Number of Sequences: 3077464 Number of extensions: 7527135 Number of successful extensions: 20024 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20018 Number of HSP's gapped (non-prelim): 4 length of query: 73 length of database: 1,040,396,356 effective HSP length: 44 effective length of query: 29 effective length of database: 904,987,940 effective search space: 26244650260 effective search space used: 26244650260 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.9 bits) S2: 87 (38.2 bits)