BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (37 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobact... 77 2e-13 UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriace... 59 6e-08 UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobact... 50 3e-05 UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria ... 45 0.001 UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobact... 42 0.006 UniRef50_B6IYK1 Cyd operon protein YbgT n=16 Tax=Proteobacteria ... 39 0.046 >UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobacteriaceae RepID=YBGT_ECOLI Length = 37 Score = 77.0 bits (188), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI Sbjct: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 >UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriaceae RepID=D0KIP0_PECWW Length = 38 Score = 58.5 bits (140), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 26/36 (72%), Positives = 31/36 (86%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILGTLLACS G+ITALA+E E+ KA ++D Sbjct: 1 MWYFAWILGTLLACSLGIITALAIEQSEASKAVEDD 36 >UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobacteria RepID=Q5E696_VIBF1 Length = 35 Score = 49.7 bits (117), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 23/35 (65%), Positives = 25/35 (71%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQE 35 MWYFAWILG LLAC+FG+I AL LEH E E Sbjct: 1 MWYFAWILGVLLACAFGIINALWLEHSEMMDKDSE 35 >UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria RepID=A1SSV9_PSYIN Length = 42 Score = 44.7 bits (104), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 24/34 (70%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQ 34 MWY AW+LG LLACS G+I AL E VE+ + + Sbjct: 1 MWYLAWMLGVLLACSLGIINALWYEQVEANENAE 34 >UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobacteria RepID=Q15VW1_PSEA6 Length = 60 Score = 42.0 bits (97), Expect = 0.006, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILG LLAC+ GVI + E ++ + +D Sbjct: 11 MWYFAWILGVLLACTLGVINVMWYEFHQNKDSIADD 46 >UniRef50_B6IYK1 Cyd operon protein YbgT n=16 Tax=Proteobacteria RepID=B6IYK1_RHOCS Length = 40 Score = 38.9 bits (89), Expect = 0.046, Method: Compositional matrix adjust. Identities = 18/36 (50%), Positives = 20/36 (55%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAW+LG LA F V+ L E E GQ D Sbjct: 1 MWYFAWLLGLPLAVVFAVLNGLWFELREDAARGQPD 36 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobact... 54 1e-06 UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriace... 51 1e-05 UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria ... 48 6e-05 UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobact... 48 7e-05 Sequences not found previously or not previously below threshold: UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobact... 49 5e-05 UniRef50_Q3JRZ2 Cyd operon protein YbgT, putative n=83 Tax=Prote... 46 4e-04 UniRef50_C4KPI5 Conserved domain protein n=25 Tax=pseudomallei g... 41 0.009 UniRef50_C8PY79 Cyd operon protein YbgT n=1 Tax=Enhydrobacter ae... 41 0.015 UniRef50_B1ZCN3 Cyd operon protein YbgT n=7 Tax=Proteobacteria R... 38 0.074 UniRef50_A5WC93 Cyd operon protein YbgT n=2 Tax=Proteobacteria R... 38 0.075 >UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobacteriaceae RepID=YBGT_ECOLI Length = 37 Score = 54.3 bits (129), Expect = 1e-06, Method: Composition-based stats. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI Sbjct: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 >UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriaceae RepID=D0KIP0_PECWW Length = 38 Score = 51.2 bits (121), Expect = 1e-05, Method: Composition-based stats. Identities = 26/36 (72%), Positives = 31/36 (86%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILGTLLACS G+ITALA+E E+ KA ++D Sbjct: 1 MWYFAWILGTLLACSLGIITALAIEQSEASKAVEDD 36 >UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobacteria RepID=Q15VW1_PSEA6 Length = 60 Score = 48.9 bits (115), Expect = 5e-05, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILG LLAC+ GVI + E ++ + +D Sbjct: 11 MWYFAWILGVLLACTLGVINVMWYEFHQNKDSIADD 46 >UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria RepID=A1SSV9_PSYIN Length = 42 Score = 48.5 bits (114), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 24/34 (70%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQ 34 MWY AW+LG LLACS G+I AL E VE+ + + Sbjct: 1 MWYLAWMLGVLLACSLGIINALWYEQVEANENAE 34 >UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobacteria RepID=Q5E696_VIBF1 Length = 35 Score = 48.5 bits (114), Expect = 7e-05, Method: Composition-based stats. Identities = 23/35 (65%), Positives = 25/35 (71%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQE 35 MWYFAWILG LLAC+FG+I AL LEH E E Sbjct: 1 MWYFAWILGVLLACAFGIINALWLEHSEMMDKDSE 35 >UniRef50_Q3JRZ2 Cyd operon protein YbgT, putative n=83 Tax=Proteobacteria RepID=Q3JRZ2_BURP1 Length = 526 Score = 45.8 bits (107), Expect = 4e-04, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 1 MWYFAWILGTLLACSFGVITALALE 25 MWYF+WILG +A FG+I A+ LE Sbjct: 474 MWYFSWILGIGVALGFGIINAMWLE 498 >UniRef50_C4KPI5 Conserved domain protein n=25 Tax=pseudomallei group RepID=C4KPI5_BURPS Length = 56 Score = 41.2 bits (95), Expect = 0.009, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 22/32 (68%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKA 32 MWYF+WILG +A +FG+I A+ LE + A Sbjct: 25 MWYFSWILGIGVALAFGIINAMWLEARQKRDA 56 >UniRef50_C8PY79 Cyd operon protein YbgT n=1 Tax=Enhydrobacter aerosaccus SK60 RepID=C8PY79_9GAMM Length = 70 Score = 40.8 bits (94), Expect = 0.015, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAG 33 MWYFAWILG A ++ AL LE+ ++ Sbjct: 1 MWYFAWILGLGFAVLLAILNALWLENADARNKA 33 >UniRef50_B1ZCN3 Cyd operon protein YbgT n=7 Tax=Proteobacteria RepID=B1ZCN3_METPB Length = 43 Score = 38.5 bits (88), Expect = 0.074, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 18/25 (72%) Query: 1 MWYFAWILGTLLACSFGVITALALE 25 MWYFAWILG LA + GV+ AL E Sbjct: 1 MWYFAWILGLGLAAAVGVLNALWYE 25 >UniRef50_A5WC93 Cyd operon protein YbgT n=2 Tax=Proteobacteria RepID=A5WC93_PSYWF Length = 51 Score = 38.5 bits (88), Expect = 0.075, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVE 28 MWYFAWILG A ++ A+ LEH + Sbjct: 1 MWYFAWILGLGFAVLLAIVNAVWLEHEQ 28 Searching..................................................done Results from round 3 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobact... 58 1e-07 UniRef50_Q3JRZ2 Cyd operon protein YbgT, putative n=83 Tax=Prote... 52 4e-06 UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobact... 51 1e-05 UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriace... 49 4e-05 UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria ... 47 3e-04 UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobact... 46 3e-04 Sequences not found previously or not previously below threshold: UniRef50_C4KPI5 Conserved domain protein n=25 Tax=pseudomallei g... 47 2e-04 UniRef50_B2T504 Cyd operon protein YbgT n=2 Tax=Burkholderia Rep... 43 0.003 UniRef50_C8PY79 Cyd operon protein YbgT n=1 Tax=Enhydrobacter ae... 42 0.006 UniRef50_A5WC93 Cyd operon protein YbgT n=2 Tax=Proteobacteria R... 41 0.014 UniRef50_B1ZCN3 Cyd operon protein YbgT n=7 Tax=Proteobacteria R... 40 0.017 >UniRef50_Q15VW1 Cyd operon protein YbgT n=18 Tax=Gammaproteobacteria RepID=Q15VW1_PSEA6 Length = 60 Score = 57.8 bits (138), Expect = 1e-07, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 24/36 (66%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILG LLAC+ GVI + E ++ + +D Sbjct: 11 MWYFAWILGVLLACTLGVINVMWYEFHQNKDSIADD 46 >UniRef50_Q3JRZ2 Cyd operon protein YbgT, putative n=83 Tax=Proteobacteria RepID=Q3JRZ2_BURP1 Length = 526 Score = 52.4 bits (124), Expect = 4e-06, Method: Composition-based stats. Identities = 15/25 (60%), Positives = 19/25 (76%) Query: 1 MWYFAWILGTLLACSFGVITALALE 25 MWYF+WILG +A FG+I A+ LE Sbjct: 474 MWYFSWILGIGVALGFGIINAMWLE 498 >UniRef50_P56100 Uncharacterized protein ybgT n=77 Tax=Enterobacteriaceae RepID=YBGT_ECOLI Length = 37 Score = 50.8 bits (120), Expect = 1e-05, Method: Composition-based stats. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI Sbjct: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI 37 >UniRef50_D0KIP0 Cyd operon protein YbgT n=4 Tax=Enterobacteriaceae RepID=D0KIP0_PECWW Length = 38 Score = 49.3 bits (116), Expect = 4e-05, Method: Composition-based stats. Identities = 26/36 (72%), Positives = 31/36 (86%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQED 36 MWYFAWILGTLLACS G+ITALA+E E+ KA ++D Sbjct: 1 MWYFAWILGTLLACSLGIITALAIEQSEASKAVEDD 36 >UniRef50_C4KPI5 Conserved domain protein n=25 Tax=pseudomallei group RepID=C4KPI5_BURPS Length = 56 Score = 46.6 bits (109), Expect = 2e-04, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 22/32 (68%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKA 32 MWYF+WILG +A +FG+I A+ LE + A Sbjct: 25 MWYFSWILGIGVALAFGIINAMWLEARQKRDA 56 >UniRef50_A1SSV9 Cyd operon protein YbgT n=46 Tax=Proteobacteria RepID=A1SSV9_PSYIN Length = 42 Score = 46.6 bits (109), Expect = 3e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 24/34 (70%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQ 34 MWY AW+LG LLACS G+I AL E VE+ + + Sbjct: 1 MWYLAWMLGVLLACSLGIINALWYEQVEANENAE 34 >UniRef50_Q5E696 Cyd operon protein YbgT n=30 Tax=Gammaproteobacteria RepID=Q5E696_VIBF1 Length = 35 Score = 46.2 bits (108), Expect = 3e-04, Method: Composition-based stats. Identities = 23/35 (65%), Positives = 25/35 (71%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAGQE 35 MWYFAWILG LLAC+FG+I AL LEH E E Sbjct: 1 MWYFAWILGVLLACAFGIINALWLEHSEMMDKDSE 35 >UniRef50_B2T504 Cyd operon protein YbgT n=2 Tax=Burkholderia RepID=B2T504_BURPP Length = 49 Score = 42.7 bits (99), Expect = 0.003, Method: Composition-based stats. Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 1 MWYFAWILGTLLACSFGVITALALE 25 MWYF WILG +A FG+I + LE Sbjct: 1 MWYFTWILGIGVALGFGIINVMWLE 25 >UniRef50_C8PY79 Cyd operon protein YbgT n=1 Tax=Enhydrobacter aerosaccus SK60 RepID=C8PY79_9GAMM Length = 70 Score = 42.0 bits (97), Expect = 0.006, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVESGKAG 33 MWYFAWILG A ++ AL LE+ ++ Sbjct: 1 MWYFAWILGLGFAVLLAILNALWLENADARNKA 33 >UniRef50_A5WC93 Cyd operon protein YbgT n=2 Tax=Proteobacteria RepID=A5WC93_PSYWF Length = 51 Score = 40.8 bits (94), Expect = 0.014, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 1 MWYFAWILGTLLACSFGVITALALEHVE 28 MWYFAWILG A ++ A+ LEH + Sbjct: 1 MWYFAWILGLGFAVLLAIVNAVWLEHEQ 28 >UniRef50_B1ZCN3 Cyd operon protein YbgT n=7 Tax=Proteobacteria RepID=B1ZCN3_METPB Length = 43 Score = 40.4 bits (93), Expect = 0.017, Method: Composition-based stats. Identities = 16/25 (64%), Positives = 18/25 (72%) Query: 1 MWYFAWILGTLLACSFGVITALALE 25 MWYFAWILG LA + GV+ AL E Sbjct: 1 MWYFAWILGLGLAAAVGVLNALWYE 25 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.320 0.134 0.453 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 232,123,335 Number of Sequences: 3077464 Number of extensions: 4338357 Number of successful extensions: 21690 Number of sequences better than 1.0e-01: 24 Number of HSP's better than 0.1 without gapping: 54 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 21636 Number of HSP's gapped (non-prelim): 55 length of query: 37 length of database: 1,040,396,356 effective HSP length: 11 effective length of query: 26 effective length of database: 1,006,544,252 effective search space: 26170150552 effective search space used: 26170150552 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 87 (38.1 bits)