BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (55 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteob... 114 1e-24 UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteob... 84 1e-15 UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID... 78 7e-14 UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteob... 77 2e-13 UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID... 72 6e-12 UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 T... 67 2e-10 UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 T... 65 1e-09 UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteoba... 63 3e-09 UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 ... 61 1e-08 UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 ... 58 9e-08 UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reineke... 41 0.011 UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma p... 39 0.038 >UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteobacteria RepID=RMF_ECO57 Length = 55 Score = 114 bits (285), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA Sbjct: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 >UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteobacteria RepID=A0KVM0_SHESA Length = 58 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/52 (71%), Positives = 43/52 (82%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRL+RA +G+QAGI GRSKE+CPY L+ RSQWLGGWRE + RV Sbjct: 1 MKRQKRDRLDRAFSKGFQAGIGGRSKELCPYANLDSRSQWLGGWREGVDGRV 52 >UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID=B4EVD2_PROMH Length = 56 Score = 78.2 bits (191), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 37/55 (67%), Positives = 43/55 (78%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRL RA +GYQAG+ GRSKE CPY ++ RS WLGGWR+AM DR +A Sbjct: 1 MKRQKRDRLARALSKGYQAGMQGRSKEQCPYFAIDARSHWLGGWRQAMEDRPGLA 55 >UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteobacteria RepID=Q7MKW6_VIBVY Length = 57 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 34/52 (65%), Positives = 44/52 (84%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS+E CPYQ ++ RS WLGGWR+A +D++ Sbjct: 1 MKRQKRDRLERAQSQGYKAGLNGRSQEECPYQQMDARSYWLGGWRDARSDKL 52 >UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID=C3NQJ0_VIBCJ Length = 70 Score = 72.0 bits (175), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 33/52 (63%), Positives = 40/52 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS + CPYQ RS WLGGWR+A D++ Sbjct: 14 MKRQKRDRLERAQSQGYKAGLNGRSHDECPYQQTEVRSYWLGGWRDARNDKL 65 >UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 Tax=Gammaproteobacteria RepID=B3PIL7_CELJU Length = 74 Score = 66.6 bits (161), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 31/50 (62%), Positives = 38/50 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 MKRQKRD+ ERA +GYQAGI GRSK +CP+++ R QWL GWRE+ D Sbjct: 1 MKRQKRDQTERAFVKGYQAGIEGRSKSLCPHESGLARQQWLNGWRESRMD 50 >UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 Tax=Oceanospirillales RepID=Q1QXW0_CHRSD Length = 69 Score = 64.7 bits (156), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 36/50 (72%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 MKRQKRDR +RA+ GY+AG+ GRS++ CP Q +N R W+ GWRE D Sbjct: 1 MKRQKRDRFQRAYVHGYKAGMTGRSRDDCPSQDINLREYWMSGWREGRGD 50 >UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteobacteria RepID=Q21JW8_SACD2 Length = 68 Score = 62.8 bits (151), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 MKRQKRD RA RGYQAG+ GRS+ +CP+ T + WL GWRE D Sbjct: 1 MKRQKRDHTSRAFTRGYQAGVEGRSRSLCPHSTGEIKQSWLTGWREGRED 50 >UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 Tax=Gammaproteobacteria RepID=Q48JX9_PSE14 Length = 108 Score = 60.8 bits (146), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 26/50 (52%), Positives = 34/50 (68%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD LERA RGYQ G+ G+S+E+CP+ + R W+ GWRE D Sbjct: 38 MRRLKRDPLERAFLRGYQYGVHGKSRELCPFTLPSVRQAWINGWREGRGD 87 >UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 Tax=Gammaproteobacteria RepID=A4VM40_PSEU5 Length = 71 Score = 58.2 bits (139), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 25/50 (50%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD +ERA RGYQ GI G+S+++CP+ R W+ GWRE D Sbjct: 1 MRRLKRDPMERAFLRGYQHGIHGKSRDLCPFSHPQVRQAWINGWREGRGD 50 >UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reinekea blandensis MED297 RepID=A4BKG7_9GAMM Length = 66 Score = 41.2 bits (95), Expect = 0.011, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 25/41 (60%) Query: 7 DRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREA 47 D L +A+Q+GY G+AG+ E CPY+ ++ W GW + Sbjct: 9 DTLNKAYQQGYMTGLAGKPNEECPYRHDVLKAAWEAGWDDG 49 >UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma proteobacterium HTCC2207 RepID=Q1YPL6_9GAMM Length = 68 Score = 39.3 bits (90), Expect = 0.038, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRS-QWLGGWREAMAD 50 MK+ KRD R+ +GYQA + GR+ PYQ + + W GWRE D Sbjct: 1 MKKHKRDLEHRSFVKGYQAAVQGRTLAALPYQEKSIMAYHWSRGWREGKED 51 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 ... 81 8e-15 UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 ... 80 2e-14 UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID... 79 4e-14 UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteob... 77 2e-13 UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteoba... 76 3e-13 UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 T... 75 7e-13 UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 T... 75 1e-12 UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteob... 74 1e-12 UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID... 74 1e-12 UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteob... 70 2e-11 Sequences not found previously or not previously below threshold: UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma p... 46 4e-04 UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reineke... 41 0.007 UniRef50_Q1MYZ8 Putative uncharacterized protein n=1 Tax=Bermane... 40 0.022 >UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 Tax=Gammaproteobacteria RepID=Q48JX9_PSE14 Length = 108 Score = 81.2 bits (199), Expect = 8e-15, Method: Composition-based stats. Identities = 26/50 (52%), Positives = 34/50 (68%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD LERA RGYQ G+ G+S+E+CP+ + R W+ GWRE D Sbjct: 38 MRRLKRDPLERAFLRGYQYGVHGKSRELCPFTLPSVRQAWINGWREGRGD 87 >UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 Tax=Gammaproteobacteria RepID=A4VM40_PSEU5 Length = 71 Score = 80.0 bits (196), Expect = 2e-14, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD +ERA RGYQ GI G+S+++CP+ R W+ GWRE D Sbjct: 1 MRRLKRDPMERAFLRGYQHGIHGKSRDLCPFSHPQVRQAWINGWREGRGD 50 >UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID=C3NQJ0_VIBCJ Length = 70 Score = 79.2 bits (194), Expect = 4e-14, Method: Composition-based stats. Identities = 33/52 (63%), Positives = 40/52 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS + CPYQ RS WLGGWR+A D++ Sbjct: 14 MKRQKRDRLERAQSQGYKAGLNGRSHDECPYQQTEVRSYWLGGWRDARNDKL 65 >UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteobacteria RepID=A0KVM0_SHESA Length = 58 Score = 76.6 bits (187), Expect = 2e-13, Method: Composition-based stats. Identities = 37/52 (71%), Positives = 43/52 (82%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRL+RA +G+QAGI GRSKE+CPY L+ RSQWLGGWRE + RV Sbjct: 1 MKRQKRDRLDRAFSKGFQAGIGGRSKELCPYANLDSRSQWLGGWREGVDGRV 52 >UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteobacteria RepID=Q21JW8_SACD2 Length = 68 Score = 76.2 bits (186), Expect = 3e-13, Method: Composition-based stats. Identities = 28/50 (56%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 MKRQKRD RA RGYQAG+ GRS+ +CP+ T + WL GWRE D Sbjct: 1 MKRQKRDHTSRAFTRGYQAGVEGRSRSLCPHSTGEIKQSWLTGWREGRED 50 >UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 Tax=Oceanospirillales RepID=Q1QXW0_CHRSD Length = 69 Score = 75.0 bits (183), Expect = 7e-13, Method: Composition-based stats. Identities = 28/51 (54%), Positives = 37/51 (72%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADR 51 MKRQKRDR +RA+ GY+AG+ GRS++ CP Q +N R W+ GWRE D+ Sbjct: 1 MKRQKRDRFQRAYVHGYKAGMTGRSRDDCPSQDINLREYWMSGWREGRGDQ 51 >UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 Tax=Gammaproteobacteria RepID=B3PIL7_CELJU Length = 74 Score = 74.6 bits (182), Expect = 1e-12, Method: Composition-based stats. Identities = 31/51 (60%), Positives = 39/51 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADR 51 MKRQKRD+ ERA +GYQAGI GRSK +CP+++ R QWL GWRE+ D+ Sbjct: 1 MKRQKRDQTERAFVKGYQAGIEGRSKSLCPHESGLARQQWLNGWRESRMDQ 51 >UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteobacteria RepID=RMF_ECO57 Length = 55 Score = 74.2 bits (181), Expect = 1e-12, Method: Composition-based stats. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA Sbjct: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 >UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID=B4EVD2_PROMH Length = 56 Score = 73.9 bits (180), Expect = 1e-12, Method: Composition-based stats. Identities = 37/55 (67%), Positives = 43/55 (78%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRL RA +GYQAG+ GRSKE CPY ++ RS WLGGWR+AM DR +A Sbjct: 1 MKRQKRDRLARALSKGYQAGMQGRSKEQCPYFAIDARSHWLGGWRQAMEDRPGLA 55 >UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteobacteria RepID=Q7MKW6_VIBVY Length = 57 Score = 70.4 bits (171), Expect = 2e-11, Method: Composition-based stats. Identities = 34/52 (65%), Positives = 44/52 (84%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS+E CPYQ ++ RS WLGGWR+A +D++ Sbjct: 1 MKRQKRDRLERAQSQGYKAGLNGRSQEECPYQQMDARSYWLGGWRDARSDKL 52 >UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma proteobacterium HTCC2207 RepID=Q1YPL6_9GAMM Length = 68 Score = 45.7 bits (107), Expect = 4e-04, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQ-WLGGWREAMAD 50 MK+ KRD R+ +GYQA + GR+ PYQ + + W GWRE D Sbjct: 1 MKKHKRDLEHRSFVKGYQAAVQGRTLAALPYQEKSIMAYHWSRGWREGKED 51 >UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reinekea blandensis MED297 RepID=A4BKG7_9GAMM Length = 66 Score = 41.5 bits (96), Expect = 0.007, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%) Query: 7 DRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMA 49 D L +A+Q+GY G+AG+ E CPY+ ++ W GW + Sbjct: 9 DTLNKAYQQGYMTGLAGKPNEECPYRHDVLKAAWEAGWDDGSG 51 >UniRef50_Q1MYZ8 Putative uncharacterized protein n=1 Tax=Bermanella marisrubri RepID=Q1MYZ8_9GAMM Length = 66 Score = 40.0 bits (92), Expect = 0.022, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 24/43 (55%) Query: 7 DRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMA 49 + LE+A++ G+ AG+ G+ +CPY+ + W GW + Sbjct: 11 ENLEKAYRHGFMAGMVGKPVLVCPYRAEMIVNAWEAGWHDGKE 53 Searching..................................................done Results from round 3 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 ... 80 2e-14 UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 ... 78 8e-14 UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID... 77 1e-13 UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteob... 75 5e-13 UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteoba... 75 6e-13 UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 T... 75 8e-13 UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 T... 73 2e-12 UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID... 72 5e-12 UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteob... 72 7e-12 UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteob... 68 7e-11 UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma p... 62 8e-09 Sequences not found previously or not previously below threshold: UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reineke... 41 0.014 UniRef50_Q1MYZ8 Putative uncharacterized protein n=1 Tax=Bermane... 41 0.016 CONVERGED! >UniRef50_Q48JX9 Ribosome modulation factor-related protein n=13 Tax=Gammaproteobacteria RepID=Q48JX9_PSE14 Length = 108 Score = 80.4 bits (197), Expect = 2e-14, Method: Composition-based stats. Identities = 26/50 (52%), Positives = 34/50 (68%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD LERA RGYQ G+ G+S+E+CP+ + R W+ GWRE D Sbjct: 38 MRRLKRDPLERAFLRGYQYGVHGKSRELCPFTLPSVRQAWINGWREGRGD 87 >UniRef50_A4VM40 Ribosome modulation factor-related protein n=11 Tax=Gammaproteobacteria RepID=A4VM40_PSEU5 Length = 71 Score = 78.1 bits (191), Expect = 8e-14, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 M+R KRD +ERA RGYQ GI G+S+++CP+ R W+ GWRE D Sbjct: 1 MRRLKRDPMERAFLRGYQHGIHGKSRDLCPFSHPQVRQAWINGWREGRGD 50 >UniRef50_C3NQJ0 Ribosome modulation factor n=13 Tax=Vibrio RepID=C3NQJ0_VIBCJ Length = 70 Score = 77.3 bits (189), Expect = 1e-13, Method: Composition-based stats. Identities = 33/52 (63%), Positives = 40/52 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS + CPYQ RS WLGGWR+A D++ Sbjct: 14 MKRQKRDRLERAQSQGYKAGLNGRSHDECPYQQTEVRSYWLGGWRDARNDKL 65 >UniRef50_A0KVM0 Ribosome modulation factor n=21 Tax=Gammaproteobacteria RepID=A0KVM0_SHESA Length = 58 Score = 75.4 bits (184), Expect = 5e-13, Method: Composition-based stats. Identities = 37/52 (71%), Positives = 43/52 (82%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRL+RA +G+QAGI GRSKE+CPY L+ RSQWLGGWRE + RV Sbjct: 1 MKRQKRDRLDRAFSKGFQAGIGGRSKELCPYANLDSRSQWLGGWREGVDGRV 52 >UniRef50_Q21JW8 Ribosome modulation factor n=4 Tax=Gammaproteobacteria RepID=Q21JW8_SACD2 Length = 68 Score = 75.4 bits (184), Expect = 6e-13, Method: Composition-based stats. Identities = 28/50 (56%), Positives = 33/50 (66%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD 50 MKRQKRD RA RGYQAG+ GRS+ +CP+ T + WL GWRE D Sbjct: 1 MKRQKRDHTSRAFTRGYQAGVEGRSRSLCPHSTGEIKQSWLTGWREGRED 50 >UniRef50_Q1QXW0 Ribosome modulation factor-related protein n=3 Tax=Oceanospirillales RepID=Q1QXW0_CHRSD Length = 69 Score = 74.6 bits (182), Expect = 8e-13, Method: Composition-based stats. Identities = 28/51 (54%), Positives = 37/51 (72%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADR 51 MKRQKRDR +RA+ GY+AG+ GRS++ CP Q +N R W+ GWRE D+ Sbjct: 1 MKRQKRDRFQRAYVHGYKAGMTGRSRDDCPSQDINLREYWMSGWREGRGDQ 51 >UniRef50_B3PIL7 Ribosome modulation factor-related protein n=3 Tax=Gammaproteobacteria RepID=B3PIL7_CELJU Length = 74 Score = 73.5 bits (179), Expect = 2e-12, Method: Composition-based stats. Identities = 31/51 (60%), Positives = 39/51 (76%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADR 51 MKRQKRD+ ERA +GYQAGI GRSK +CP+++ R QWL GWRE+ D+ Sbjct: 1 MKRQKRDQTERAFVKGYQAGIEGRSKSLCPHESGLARQQWLNGWRESRMDQ 51 >UniRef50_B4EVD2 Ribosome modulation factor n=3 Tax=Proteus RepID=B4EVD2_PROMH Length = 56 Score = 71.9 bits (175), Expect = 5e-12, Method: Composition-based stats. Identities = 37/55 (67%), Positives = 43/55 (78%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRL RA +GYQAG+ GRSKE CPY ++ RS WLGGWR+AM DR +A Sbjct: 1 MKRQKRDRLARALSKGYQAGMQGRSKEQCPYFAIDARSHWLGGWRQAMEDRPGLA 55 >UniRef50_P0AFW3 Ribosome modulation factor n=72 Tax=Gammaproteobacteria RepID=RMF_ECO57 Length = 55 Score = 71.6 bits (174), Expect = 7e-12, Method: Composition-based stats. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA Sbjct: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRVVMA 55 >UniRef50_Q7MKW6 Ribosome modulation factor n=37 Tax=Gammaproteobacteria RepID=Q7MKW6_VIBVY Length = 57 Score = 68.5 bits (166), Expect = 7e-11, Method: Composition-based stats. Identities = 34/52 (65%), Positives = 44/52 (84%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV 52 MKRQKRDRLERA +GY+AG+ GRS+E CPYQ ++ RS WLGGWR+A +D++ Sbjct: 1 MKRQKRDRLERAQSQGYKAGLNGRSQEECPYQQMDARSYWLGGWRDARSDKL 52 >UniRef50_Q1YPL6 Putative uncharacterized protein n=1 Tax=gamma proteobacterium HTCC2207 RepID=Q1YPL6_9GAMM Length = 68 Score = 61.5 bits (148), Expect = 8e-09, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Query: 1 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQ-WLGGWREAMAD 50 MK+ KRD R+ +GYQA + GR+ PYQ + + W GWRE D Sbjct: 1 MKKHKRDLEHRSFVKGYQAAVQGRTLAALPYQEKSIMAYHWSRGWREGKED 51 >UniRef50_A4BKG7 Putative uncharacterized protein n=1 Tax=Reinekea blandensis MED297 RepID=A4BKG7_9GAMM Length = 66 Score = 40.7 bits (94), Expect = 0.014, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%) Query: 7 DRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMA 49 D L +A+Q+GY G+AG+ E CPY+ ++ W GW + Sbjct: 9 DTLNKAYQQGYMTGLAGKPNEECPYRHDVLKAAWEAGWDDGSG 51 >UniRef50_Q1MYZ8 Putative uncharacterized protein n=1 Tax=Bermanella marisrubri RepID=Q1MYZ8_9GAMM Length = 66 Score = 40.7 bits (94), Expect = 0.016, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 23/41 (56%) Query: 9 LERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMA 49 LE+A++ G+ AG+ G+ +CPY+ + W GW + Sbjct: 13 LEKAYRHGFMAGMVGKPVLVCPYRAEMIVNAWEAGWHDGKE 53 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.312 0.141 0.470 Lambda K H 0.267 0.0426 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 376,491,360 Number of Sequences: 3077464 Number of extensions: 11051308 Number of successful extensions: 28080 Number of sequences better than 1.0e-01: 16 Number of HSP's better than 0.1 without gapping: 43 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 28035 Number of HSP's gapped (non-prelim): 46 length of query: 55 length of database: 1,040,396,356 effective HSP length: 28 effective length of query: 27 effective length of database: 954,227,364 effective search space: 25764138828 effective search space used: 25764138828 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 87 (38.1 bits)