BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (55 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64629 Uncharacterized protein yhfL n=87 Tax=Enterobact... 115 5e-25 UniRef50_C9Y267 Uncharacterized protein yhfL n=4 Tax=Enterobacte... 92 5e-18 UniRef50_C2LKA0 Lipoprotein n=3 Tax=Proteus RepID=C2LKA0_PROMI 77 1e-13 UniRef50_Q88NG0 Lipoprotein, putative n=6 Tax=Pseudomonas RepID=... 64 2e-09 >UniRef50_P64629 Uncharacterized protein yhfL n=87 Tax=Enterobacteriaceae RepID=YHFL_ECO57 Length = 55 Score = 115 bits (287), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ Sbjct: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 >UniRef50_C9Y267 Uncharacterized protein yhfL n=4 Tax=Enterobacteriaceae RepID=C9Y267_CROTZ Length = 56 Score = 92.0 bits (227), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 41/55 (74%), Positives = 49/55 (89%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 M IK+A++ AVL++LTACTGHIEN++K CSYDYLLHPAISISKIIGGCGP A+ Sbjct: 1 MKHVIKLAMLAAVLSSLTACTGHIENKNKTCSYDYLLHPAISISKIIGGCGPAAE 55 >UniRef50_C2LKA0 Lipoprotein n=3 Tax=Proteus RepID=C2LKA0_PROMI Length = 55 Score = 77.4 bits (189), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 44/55 (80%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 M F+K+AL+ + + +T CTG + N++K+C+YDYLLHPA+SISKIIGGCG T + Sbjct: 1 MKNFVKIALIASFVTVMTGCTGSVYNKEKDCNYDYLLHPAVSISKIIGGCGDTNK 55 >UniRef50_Q88NG0 Lipoprotein, putative n=6 Tax=Pseudomonas RepID=Q88NG0_PSEPK Length = 63 Score = 63.5 bits (153), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 25/36 (69%), Positives = 31/36 (86%) Query: 17 LTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGP 52 L+ CTG + N+ KNC+YDYL HP++SISKIIGGCGP Sbjct: 20 LSGCTGQVYNQPKNCTYDYLFHPSVSISKIIGGCGP 55 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64629 Uncharacterized protein yhfL n=87 Tax=Enterobact... 89 4e-17 UniRef50_C2LKA0 Lipoprotein n=3 Tax=Proteus RepID=C2LKA0_PROMI 87 2e-16 UniRef50_C9Y267 Uncharacterized protein yhfL n=4 Tax=Enterobacte... 86 4e-16 UniRef50_Q88NG0 Lipoprotein, putative n=6 Tax=Pseudomonas RepID=... 70 2e-11 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P64629 Uncharacterized protein yhfL n=87 Tax=Enterobacteriaceae RepID=YHFL_ECO57 Length = 55 Score = 89.2 bits (220), Expect = 4e-17, Method: Composition-based stats. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ Sbjct: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 >UniRef50_C2LKA0 Lipoprotein n=3 Tax=Proteus RepID=C2LKA0_PROMI Length = 55 Score = 86.5 bits (213), Expect = 2e-16, Method: Composition-based stats. Identities = 31/55 (56%), Positives = 44/55 (80%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 M F+K+AL+ + + +T CTG + N++K+C+YDYLLHPA+SISKIIGGCG T + Sbjct: 1 MKNFVKIALIASFVTVMTGCTGSVYNKEKDCNYDYLLHPAVSISKIIGGCGDTNK 55 >UniRef50_C9Y267 Uncharacterized protein yhfL n=4 Tax=Enterobacteriaceae RepID=C9Y267_CROTZ Length = 56 Score = 85.8 bits (211), Expect = 4e-16, Method: Composition-based stats. Identities = 41/55 (74%), Positives = 49/55 (89%) Query: 1 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 M IK+A++ AVL++LTACTGHIEN++K CSYDYLLHPAISISKIIGGCGP A+ Sbjct: 1 MKHVIKLAMLAAVLSSLTACTGHIENKNKTCSYDYLLHPAISISKIIGGCGPAAE 55 >UniRef50_Q88NG0 Lipoprotein, putative n=6 Tax=Pseudomonas RepID=Q88NG0_PSEPK Length = 63 Score = 70.0 bits (170), Expect = 2e-11, Method: Composition-based stats. Identities = 25/39 (64%), Positives = 32/39 (82%) Query: 17 LTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTAQ 55 L+ CTG + N+ KNC+YDYL HP++SISKIIGGCGP + Sbjct: 20 LSGCTGQVYNQPKNCTYDYLFHPSVSISKIIGGCGPIDK 58 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.324 0.145 0.422 Lambda K H 0.267 0.0431 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 224,926,717 Number of Sequences: 3077464 Number of extensions: 5900177 Number of successful extensions: 14102 Number of sequences better than 1.0e-01: 4 Number of HSP's better than 0.1 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14094 Number of HSP's gapped (non-prelim): 8 length of query: 55 length of database: 1,040,396,356 effective HSP length: 28 effective length of query: 27 effective length of database: 954,227,364 effective search space: 25764138828 effective search space used: 25764138828 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 87 (38.0 bits)