BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (64 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P33229 Restriction alleviation and modification enhance... 133 1e-30 UniRef50_A8S2J1 Putative uncharacterized protein n=1 Tax=Clostri... 40 0.025 UniRef50_C6BC92 Putative uncharacterized protein n=1 Tax=Ralston... 39 0.063 >UniRef50_P33229 Restriction alleviation and modification enhancement protein n=9 Tax=Enterobacteriaceae RepID=LAR_ECOLI Length = 64 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG 60 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG Sbjct: 1 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG 60 Query: 61 GVHV 64 GVHV Sbjct: 61 GVHV 64 >UniRef50_A8S2J1 Putative uncharacterized protein n=1 Tax=Clostridium bolteae ATCC BAA-613 RepID=A8S2J1_9CLOT Length = 75 Score = 40.0 bits (92), Expect = 0.025, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 18/67 (26%) Query: 5 NVKPCPFCGCPSVTVKAI--------------SGYYRAKCN----GCESRTGYGGSEKEA 46 ++K CPFCG ++ + +GYY A CN GC + TGY + K A Sbjct: 7 DLKACPFCGSKNIVIDTCHDLGDCENFERCEDTGYYSAVCNRNDGGCGASTGYKPTIKAA 66 Query: 47 LERWNKR 53 +E WN+R Sbjct: 67 VEAWNRR 73 >UniRef50_C6BC92 Putative uncharacterized protein n=1 Tax=Ralstonia pickettii 12D RepID=C6BC92_RALP1 Length = 67 Score = 38.5 bits (88), Expect = 0.063, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 4 DNVKPCPFCGCPSVTVKAISGY--YRAKCNGCESRTGYGGSEKEALERWNKRT 54 +++ PCPFCGC ++A +G+ + C+GC + A+ERWN R Sbjct: 2 NDLLPCPFCGCTINLIEASNGHESHFVFCDGCGAEGPAAKDRPYAVERWNTRA 54 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P33229 Restriction alleviation and modification enhance... 125 4e-28 Sequences not found previously or not previously below threshold: UniRef50_A8S2J1 Putative uncharacterized protein n=1 Tax=Clostri... 40 0.017 UniRef50_C6BC92 Putative uncharacterized protein n=1 Tax=Ralston... 40 0.019 UniRef50_A0ZYQ1 Putative uncharacterized protein n=1 Tax=Archaea... 38 0.084 CONVERGED! >UniRef50_P33229 Restriction alleviation and modification enhancement protein n=9 Tax=Enterobacteriaceae RepID=LAR_ECOLI Length = 64 Score = 125 bits (314), Expect = 4e-28, Method: Composition-based stats. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG 60 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG Sbjct: 1 MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNG 60 Query: 61 GVHV 64 GVHV Sbjct: 61 GVHV 64 >UniRef50_A8S2J1 Putative uncharacterized protein n=1 Tax=Clostridium bolteae ATCC BAA-613 RepID=A8S2J1_9CLOT Length = 75 Score = 40.4 bits (93), Expect = 0.017, Method: Composition-based stats. Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 18/67 (26%) Query: 5 NVKPCPFCGCPSVTVKAI--------------SGYYRAKCN----GCESRTGYGGSEKEA 46 ++K CPFCG ++ + +GYY A CN GC + TGY + K A Sbjct: 7 DLKACPFCGSKNIVIDTCHDLGDCENFERCEDTGYYSAVCNRNDGGCGASTGYKPTIKAA 66 Query: 47 LERWNKR 53 +E WN+R Sbjct: 67 VEAWNRR 73 >UniRef50_C6BC92 Putative uncharacterized protein n=1 Tax=Ralstonia pickettii 12D RepID=C6BC92_RALP1 Length = 67 Score = 40.4 bits (93), Expect = 0.019, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 4 DNVKPCPFCGCPSVTVKAISGY--YRAKCNGCESRTGYGGSEKEALERWNKR 53 +++ PCPFCGC ++A +G+ + C+GC + A+ERWN R Sbjct: 2 NDLLPCPFCGCTINLIEASNGHESHFVFCDGCGAEGPAAKDRPYAVERWNTR 53 >UniRef50_A0ZYQ1 Putative uncharacterized protein n=1 Tax=Archaeal BJ1 virus RepID=A0ZYQ1_9CAUD Length = 101 Score = 38.1 bits (87), Expect = 0.084, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Query: 4 DNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEK---EALERW 50 D+++PCP C + A YYR KC+GC R G +E +A+++W Sbjct: 3 DSIEPCPNCETDVLVAGAQGPYYRWKCHGCGERWGANPTEPIAYDAVDQW 52 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.317 0.135 0.453 Lambda K H 0.267 0.0418 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 300,604,642 Number of Sequences: 3077464 Number of extensions: 9706313 Number of successful extensions: 21597 Number of sequences better than 1.0e-01: 4 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 21588 Number of HSP's gapped (non-prelim): 9 length of query: 64 length of database: 1,040,396,356 effective HSP length: 36 effective length of query: 28 effective length of database: 929,607,652 effective search space: 26029014256 effective search space used: 26029014256 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 87 (38.1 bits)