BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (89 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0ADQ1 Protein yihD n=225 Tax=cellular organisms RepID=... 180 1e-44 UniRef50_P44900 Uncharacterized protein HI0845 n=33 Tax=Gammapro... 119 2e-26 UniRef50_A1SR29 Putative uncharacterized protein n=1 Tax=Psychro... 93 2e-18 >UniRef50_P0ADQ1 Protein yihD n=225 Tax=cellular organisms RepID=YIHD_ECO57 Length = 89 Score = 180 bits (456), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 89/89 (100%), Positives = 89/89 (100%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA Sbjct: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVIKE 89 KDAVIPGLQKDYEEDFKTALLRARGVIKE Sbjct: 61 KDAVIPGLQKDYEEDFKTALLRARGVIKE 89 >UniRef50_P44900 Uncharacterized protein HI0845 n=33 Tax=Gammaproteobacteria RepID=Y845_HAEIN Length = 88 Score = 119 bits (299), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 58/88 (65%), Positives = 71/88 (80%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 MKCKRLNEV+ELLQ W K+ DL+L++ LQK+A ESGF L +LTD+++IY LKM + Sbjct: 1 MKCKRLNEVLELLQSYWSKDSDLSLMEILQKIANESGFQKPLNELTDEVIIYQLKMDGTD 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVIK 88 K IPGL+KDYEEDFKTALLRARG+IK Sbjct: 61 KYEPIPGLKKDYEEDFKTALLRARGIIK 88 >UniRef50_A1SR29 Putative uncharacterized protein n=1 Tax=Psychromonas ingrahamii 37 RepID=A1SR29_PSYIN Length = 87 Score = 93.2 bits (230), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/87 (50%), Positives = 65/87 (74%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 M+ R+N+VIELL+P W K +L+L++ L +L +ESGFD L L D+++IYHLKM Sbjct: 1 MQSDRINKVIELLKPYWLKNKELSLIETLVRLTQESGFDKPLEKLNDEVIIYHLKMDQIE 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVI 87 + ++PG+ KD ++DFKTALL+ARG+I Sbjct: 61 ANEMLPGIAKDCKDDFKTALLQARGLI 87 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0ADQ1 Protein yihD n=225 Tax=cellular organisms RepID=... 136 2e-31 UniRef50_P44900 Uncharacterized protein HI0845 n=33 Tax=Gammapro... 136 2e-31 UniRef50_A1SR29 Putative uncharacterized protein n=1 Tax=Psychro... 130 9e-30 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P0ADQ1 Protein yihD n=225 Tax=cellular organisms RepID=YIHD_ECO57 Length = 89 Score = 136 bits (343), Expect = 2e-31, Method: Composition-based stats. Identities = 89/89 (100%), Positives = 89/89 (100%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA Sbjct: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVIKE 89 KDAVIPGLQKDYEEDFKTALLRARGVIKE Sbjct: 61 KDAVIPGLQKDYEEDFKTALLRARGVIKE 89 >UniRef50_P44900 Uncharacterized protein HI0845 n=33 Tax=Gammaproteobacteria RepID=Y845_HAEIN Length = 88 Score = 136 bits (342), Expect = 2e-31, Method: Composition-based stats. Identities = 58/88 (65%), Positives = 71/88 (80%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 MKCKRLNEV+ELLQ W K+ DL+L++ LQK+A ESGF L +LTD+++IY LKM + Sbjct: 1 MKCKRLNEVLELLQSYWSKDSDLSLMEILQKIANESGFQKPLNELTDEVIIYQLKMDGTD 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVIK 88 K IPGL+KDYEEDFKTALLRARG+IK Sbjct: 61 KYEPIPGLKKDYEEDFKTALLRARGIIK 88 >UniRef50_A1SR29 Putative uncharacterized protein n=1 Tax=Psychromonas ingrahamii 37 RepID=A1SR29_PSYIN Length = 87 Score = 130 bits (328), Expect = 9e-30, Method: Composition-based stats. Identities = 44/87 (50%), Positives = 65/87 (74%) Query: 1 MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA 60 M+ R+N+VIELL+P W K +L+L++ L +L +ESGFD L L D+++IYHLKM Sbjct: 1 MQSDRINKVIELLKPYWLKNKELSLIETLVRLTQESGFDKPLEKLNDEVIIYHLKMDQIE 60 Query: 61 KDAVIPGLQKDYEEDFKTALLRARGVI 87 + ++PG+ KD ++DFKTALL+ARG+I Sbjct: 61 ANEMLPGIAKDCKDDFKTALLQARGLI 87 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.312 0.143 0.384 Lambda K H 0.267 0.0434 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 325,201,294 Number of Sequences: 3077464 Number of extensions: 10405276 Number of successful extensions: 30007 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 30001 Number of HSP's gapped (non-prelim): 6 length of query: 89 length of database: 1,040,396,356 effective HSP length: 59 effective length of query: 30 effective length of database: 858,825,980 effective search space: 25764779400 effective search space used: 25764779400 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.3 bits) S2: 87 (38.0 bits)