BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (69 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0TBK7 Uncharacterized protein yibT n=97 Tax=Enterobact... 134 1e-30 UniRef50_C6DG43 DNA polymerase III, theta subunit n=6 Tax=Entero... 41 0.013 >UniRef50_Q0TBK7 Uncharacterized protein yibT n=97 Tax=Enterobacteriaceae RepID=YIBT_ECOL5 Length = 69 Score = 134 bits (336), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 66/67 (98%), Positives = 67/67 (100%) Query: 1 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRL 60 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYR+L Sbjct: 1 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRQL 60 Query: 61 YRPKQVE 67 YRPKQVE Sbjct: 61 YRPKQVE 67 >UniRef50_C6DG43 DNA polymerase III, theta subunit n=6 Tax=Enterobacteriaceae RepID=C6DG43_PECCP Length = 65 Score = 40.8 bits (94), Expect = 0.013, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 31/53 (58%) Query: 13 DKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRLYRPKQ 65 ++ DF AS+ AF E +K + I IP E P + +RL +YR +YRP+Q Sbjct: 13 EQYTDFAASTIAFMESQEKKIDADEISRRIPQEKRPFFNERLGHYRDIYRPQQ 65 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q0TBK7 Uncharacterized protein yibT n=97 Tax=Enterobact... 123 2e-27 Sequences not found previously or not previously below threshold: UniRef50_C6DG43 DNA polymerase III, theta subunit n=6 Tax=Entero... 41 0.010 CONVERGED! >UniRef50_Q0TBK7 Uncharacterized protein yibT n=97 Tax=Enterobacteriaceae RepID=YIBT_ECOL5 Length = 69 Score = 123 bits (309), Expect = 2e-27, Method: Composition-based stats. Identities = 66/67 (98%), Positives = 67/67 (100%) Query: 1 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRL 60 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYR+L Sbjct: 1 MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRQL 60 Query: 61 YRPKQVE 67 YRPKQVE Sbjct: 61 YRPKQVE 67 >UniRef50_C6DG43 DNA polymerase III, theta subunit n=6 Tax=Enterobacteriaceae RepID=C6DG43_PECCP Length = 65 Score = 41.1 bits (95), Expect = 0.010, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 31/53 (58%) Query: 13 DKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRLYRPKQ 65 ++ DF AS+ AF E +K + I IP E P + +RL +YR +YRP+Q Sbjct: 13 EQYTDFAASTIAFMESQEKKIDADEISRRIPQEKRPFFNERLGHYRDIYRPQQ 65 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.309 0.143 0.445 Lambda K H 0.267 0.0427 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 286,362,099 Number of Sequences: 3077464 Number of extensions: 9759435 Number of successful extensions: 24654 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 24650 Number of HSP's gapped (non-prelim): 4 length of query: 69 length of database: 1,040,396,356 effective HSP length: 41 effective length of query: 28 effective length of database: 914,220,332 effective search space: 25598169296 effective search space used: 25598169296 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.1 bits) S2: 87 (38.1 bits)