/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/d5687b23008eb498/hh.c3g27A_.model.1.pdb
MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKPPDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA
CHHHHHHCCCCCCEEEEEEEECCCCCEEEEEECCCCCCCCCEECCCCCEEEEEEHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
----++++++++++++++++++++++++++++++---------+++++++++++++++++++++++++++++++++++++-+++++++++++++--  HHscore 1.000, sequence id 99%  /bmm/www/servers/phyre2/public_html/phyre2_output/d5687b23008eb498/hh.c3g27A_.model.1.pdb

83% of protein confidently modelled...
More than 50% of protein confidently modelled - using mergeProteins.py
Protein length: 96  of which strand: 22
Estimated time per simulation: 3 minutes
Number of repetitions of folding: 11
Estimated total CPU time: 0 hours
Estimated wallclock time on 100 processors: 0 hours