BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (36 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_C1P620 Uncharacterized protein yshB n=11 Tax=Enterobact... 49 4e-05 >UniRef50_C1P620 Uncharacterized protein yshB n=11 Tax=Enterobacteriaceae RepID=YSHB_ECOLI Length = 36 Score = 49.4 bits (116), Expect = 4e-05, Method: Composition-based stats. Identities = 36/36 (100%), Positives = 36/36 (100%) Query: 1 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS 36 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS Sbjct: 1 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS 36 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C1P620 Uncharacterized protein yshB n=11 Tax=Enterobact... 49 4e-05 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_C1P620 Uncharacterized protein yshB n=11 Tax=Enterobacteriaceae RepID=YSHB_ECOLI Length = 36 Score = 49.4 bits (116), Expect = 4e-05, Method: Composition-based stats. Identities = 36/36 (100%), Positives = 36/36 (100%) Query: 1 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS 36 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS Sbjct: 1 MLESIINLVSSGAVDSHTPQTAVAAVLCAAMIGLFS 36 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.321 0.128 0.346 Lambda K H 0.267 0.0427 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 194,156,400 Number of Sequences: 3077464 Number of extensions: 4611482 Number of successful extensions: 18674 Number of sequences better than 1.0e-01: 5 Number of HSP's better than 0.1 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18664 Number of HSP's gapped (non-prelim): 10 length of query: 36 length of database: 1,040,396,356 effective HSP length: 10 effective length of query: 26 effective length of database: 1,009,621,716 effective search space: 26250164616 effective search space used: 26250164616 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 87 (38.1 bits)