BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (73 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9S4X1 Uncharacterized protein yubE n=76 Tax=root RepID... 149 4e-35 UniRef50_A6TIQ4 Putative uncharacterized protein n=2 Tax=Klebsie... 55 9e-07 >UniRef50_Q9S4X1 Uncharacterized protein yubE n=76 Tax=root RepID=YUBE_ECOLI Length = 73 Score = 149 bits (375), Expect = 4e-35, Method: Compositional matrix adjust. Identities = 73/73 (100%), Positives = 73/73 (100%) Query: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA Sbjct: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 Query: 61 YTEILELDACFKD 73 YTEILELDACFKD Sbjct: 61 YTEILELDACFKD 73 >UniRef50_A6TIQ4 Putative uncharacterized protein n=2 Tax=Klebsiella pneumoniae RepID=A6TIQ4_KLEP7 Length = 73 Score = 54.7 bits (130), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 32/73 (43%), Positives = 42/73 (57%) Query: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 MNY GH+ LR D+A +AN +CDL+ L +E + D L ERLA +L R + L EA Sbjct: 1 MNYDGHEALRRDMAGLANNLCDLKTTLKVLEDTYHYRYDGLAERLAGISLRRLSVLMDEA 60 Query: 61 YTEILELDACFKD 73 + L LD F D Sbjct: 61 FNIALMLDESFLD 73 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q9S4X1 Uncharacterized protein yubE n=76 Tax=root RepID... 94 1e-18 UniRef50_A6TIQ4 Putative uncharacterized protein n=2 Tax=Klebsie... 93 2e-18 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q9S4X1 Uncharacterized protein yubE n=76 Tax=root RepID=YUBE_ECOLI Length = 73 Score = 94.3 bits (233), Expect = 1e-18, Method: Composition-based stats. Identities = 73/73 (100%), Positives = 73/73 (100%) Query: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA Sbjct: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 Query: 61 YTEILELDACFKD 73 YTEILELDACFKD Sbjct: 61 YTEILELDACFKD 73 >UniRef50_A6TIQ4 Putative uncharacterized protein n=2 Tax=Klebsiella pneumoniae RepID=A6TIQ4_KLEP7 Length = 73 Score = 93.5 bits (231), Expect = 2e-18, Method: Composition-based stats. Identities = 32/73 (43%), Positives = 42/73 (57%) Query: 1 MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEA 60 MNY GH+ LR D+A +AN +CDL+ L +E + D L ERLA +L R + L EA Sbjct: 1 MNYDGHEALRRDMAGLANNLCDLKTTLKVLEDTYHYRYDGLAERLAGISLRRLSVLMDEA 60 Query: 61 YTEILELDACFKD 73 + L LD F D Sbjct: 61 FNIALMLDESFLD 73 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.332 0.144 0.391 Lambda K H 0.267 0.0423 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 260,369,920 Number of Sequences: 3077464 Number of extensions: 7929132 Number of successful extensions: 29948 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29943 Number of HSP's gapped (non-prelim): 5 length of query: 73 length of database: 1,040,396,356 effective HSP length: 44 effective length of query: 29 effective length of database: 904,987,940 effective search space: 26244650260 effective search space used: 26244650260 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 87 (38.1 bits)