BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (113 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P18353 Protein trbJ n=31 Tax=root RepID=TRBJ_ECOLI 223 1e-57 UniRef50_B1VCA6 Putative TrbJ protein n=1 Tax=Escherichia coli R... 151 5e-36 >UniRef50_P18353 Protein trbJ n=31 Tax=root RepID=TRBJ_ECOLI Length = 113 Score = 223 bits (569), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV Sbjct: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 Query: 61 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK 113 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK Sbjct: 61 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK 113 >UniRef50_B1VCA6 Putative TrbJ protein n=1 Tax=Escherichia coli RepID=B1VCA6_ECOLX Length = 94 Score = 151 bits (382), Expect = 5e-36, Method: Compositional matrix adjust. Identities = 76/81 (93%), Positives = 77/81 (95%) Query: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 MPPVLWRGWIPFCRCTE KKVRNKQVVLLIAGISGI TGIIVSLNIPFIRQGLFYPASPV Sbjct: 1 MPPVLWRGWIPFCRCTEGKKVRNKQVVLLIAGISGIATGIIVSLNIPFIRQGLFYPASPV 60 Query: 61 EIVVSLSLTFSVSVVFFVGAI 81 EIVVSL LTFSVSVVFFVG + Sbjct: 61 EIVVSLCLTFSVSVVFFVGQL 81 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P18353 Protein trbJ n=31 Tax=root RepID=TRBJ_ECOLI 208 4e-53 UniRef50_B1VCA6 Putative TrbJ protein n=1 Tax=Escherichia coli R... 154 6e-37 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P18353 Protein trbJ n=31 Tax=root RepID=TRBJ_ECOLI Length = 113 Score = 208 bits (530), Expect = 4e-53, Method: Composition-based stats. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV Sbjct: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 Query: 61 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK 113 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK Sbjct: 61 EIVVSLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK 113 >UniRef50_B1VCA6 Putative TrbJ protein n=1 Tax=Escherichia coli RepID=B1VCA6_ECOLX Length = 94 Score = 154 bits (390), Expect = 6e-37, Method: Composition-based stats. Identities = 76/81 (93%), Positives = 77/81 (95%) Query: 1 MPPVLWRGWIPFCRCTEEKKVRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPV 60 MPPVLWRGWIPFCRCTE KKVRNKQVVLLIAGISGI TGIIVSLNIPFIRQGLFYPASPV Sbjct: 1 MPPVLWRGWIPFCRCTEGKKVRNKQVVLLIAGISGIATGIIVSLNIPFIRQGLFYPASPV 60 Query: 61 EIVVSLSLTFSVSVVFFVGAI 81 EIVVSL LTFSVSVVFFVG + Sbjct: 61 EIVVSLCLTFSVSVVFFVGQL 81 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.317 0.143 0.457 Lambda K H 0.267 0.0439 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 467,894,764 Number of Sequences: 3077464 Number of extensions: 16480405 Number of successful extensions: 49005 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 49000 Number of HSP's gapped (non-prelim): 5 length of query: 113 length of database: 1,040,396,356 effective HSP length: 80 effective length of query: 33 effective length of database: 794,199,236 effective search space: 26208574788 effective search space used: 26208574788 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 87 (38.0 bits)