BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (33 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8XAT0 Putative rho operon leader peptide n=28 Tax=Ente... 67 1e-10 UniRef50_D2TH63 Putative rho operon leader peptide n=1 Tax=Citro... 43 0.002 >UniRef50_Q8XAT0 Putative rho operon leader peptide n=28 Tax=Enterobacteriaceae RepID=LPRH_ECO57 Length = 33 Score = 67.4 bits (163), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR Sbjct: 1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 >UniRef50_D2TH63 Putative rho operon leader peptide n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TH63_CITRO Length = 30 Score = 43.1 bits (100), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/29 (62%), Positives = 22/29 (75%) Query: 4 EQISGSSLNPSCRFSSAYSPVTRQRKDMS 32 ++ S NPSCRFS+AY PVTRQR DM+ Sbjct: 2 DRFWALSFNPSCRFSAAYFPVTRQRTDMN 30 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: Sequences not found previously or not previously below threshold: UniRef50_Q8XAT0 Putative rho operon leader peptide n=28 Tax=Ente... 40 0.019 UniRef50_D2TH63 Putative rho operon leader peptide n=1 Tax=Citro... 40 0.026 CONVERGED! >UniRef50_Q8XAT0 Putative rho operon leader peptide n=28 Tax=Enterobacteriaceae RepID=LPRH_ECO57 Length = 33 Score = 40.2 bits (92), Expect = 0.019, Method: Composition-based stats. Identities = 33/33 (100%), Positives = 33/33 (100%) Query: 1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR Sbjct: 1 MRSEQISGSSLNPSCRFSSAYSPVTRQRKDMSR 33 >UniRef50_D2TH63 Putative rho operon leader peptide n=1 Tax=Citrobacter rodentium ICC168 RepID=D2TH63_CITRO Length = 30 Score = 39.8 bits (91), Expect = 0.026, Method: Composition-based stats. Identities = 18/23 (78%), Positives = 20/23 (86%) Query: 10 SLNPSCRFSSAYSPVTRQRKDMS 32 S NPSCRFS+AY PVTRQR DM+ Sbjct: 8 SFNPSCRFSAAYFPVTRQRTDMN 30 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.313 0.119 0.328 Lambda K H 0.267 0.0370 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,961,195 Number of Sequences: 3077464 Number of extensions: 1588759 Number of successful extensions: 3085 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3081 Number of HSP's gapped (non-prelim): 4 length of query: 33 length of database: 1,040,396,356 effective HSP length: 8 effective length of query: 25 effective length of database: 1,015,776,644 effective search space: 25394416100 effective search space used: 25394416100 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 87 (38.3 bits)