BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (62 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64477 Uncharacterized protein ydiH n=80 Tax=Bacteria R... 125 4e-28 UniRef50_D2TGW5 Putative uncharacterized protein n=3 Tax=Enterob... 116 2e-25 UniRef50_Q7N314 Similarities with unknown protein YdiH of Escher... 45 7e-04 >UniRef50_P64477 Uncharacterized protein ydiH n=80 Tax=Bacteria RepID=YDIH_ECO57 Length = 62 Score = 125 bits (314), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG Sbjct: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 Query: 61 VH 62 VH Sbjct: 61 VH 62 >UniRef50_D2TGW5 Putative uncharacterized protein n=3 Tax=Enterobacteriaceae RepID=D2TGW5_CITRO Length = 69 Score = 116 bits (291), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 56/62 (90%), Positives = 60/62 (96%) Query: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 M++QLDP QLAIEFLRRD++ LSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG Sbjct: 8 MTSQLDPAQLAIEFLRRDKTELSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 67 Query: 61 VH 62 VH Sbjct: 68 VH 69 >UniRef50_Q7N314 Similarities with unknown protein YdiH of Escherichia coli n=1 Tax=Photorhabdus luminescens subsp. laumondii RepID=Q7N314_PHOLL Length = 86 Score = 45.1 bits (105), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Query: 2 STQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAE--LKEEIYFAWR 58 S D LA E+LRR LSPAQYL L++LE EF +LL + E LK++ W+ Sbjct: 24 SVMTDAQTLAFEYLRRSDKKLSPAQYLLELRKLEAEFNELLQIDDLEQKLKDDSIRTWK 82 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P64477 Uncharacterized protein ydiH n=80 Tax=Bacteria R... 87 1e-16 UniRef50_D2TGW5 Putative uncharacterized protein n=3 Tax=Enterob... 86 3e-16 UniRef50_Q7N314 Similarities with unknown protein YdiH of Escher... 73 3e-12 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P64477 Uncharacterized protein ydiH n=80 Tax=Bacteria RepID=YDIH_ECO57 Length = 62 Score = 87.4 bits (215), Expect = 1e-16, Method: Composition-based stats. Identities = 62/62 (100%), Positives = 62/62 (100%) Query: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG Sbjct: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 Query: 61 VH 62 VH Sbjct: 61 VH 62 >UniRef50_D2TGW5 Putative uncharacterized protein n=3 Tax=Enterobacteriaceae RepID=D2TGW5_CITRO Length = 69 Score = 86.2 bits (212), Expect = 3e-16, Method: Composition-based stats. Identities = 56/62 (90%), Positives = 60/62 (96%) Query: 1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 60 M++QLDP QLAIEFLRRD++ LSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG Sbjct: 8 MTSQLDPAQLAIEFLRRDKTELSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLG 67 Query: 61 VH 62 VH Sbjct: 68 VH 69 >UniRef50_Q7N314 Similarities with unknown protein YdiH of Escherichia coli n=1 Tax=Photorhabdus luminescens subsp. laumondii RepID=Q7N314_PHOLL Length = 86 Score = 72.8 bits (177), Expect = 3e-12, Method: Composition-based stats. Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Query: 2 STQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAE--LKEEIYFAWR 58 S D LA E+LRR LSPAQYL L++LE EF +LL + E LK++ W+ Sbjct: 24 SVMTDAQTLAFEYLRRSDKKLSPAQYLLELRKLEAEFNELLQIDDLEQKLKDDSIRTWK 82 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.315 0.136 0.373 Lambda K H 0.267 0.0415 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 225,680,928 Number of Sequences: 3077464 Number of extensions: 6056821 Number of successful extensions: 20123 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 20116 Number of HSP's gapped (non-prelim): 6 length of query: 62 length of database: 1,040,396,356 effective HSP length: 34 effective length of query: 28 effective length of database: 935,762,580 effective search space: 26201352240 effective search space used: 26201352240 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 87 (38.1 bits)