BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (70 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P76118 Uncharacterized protein yncH n=32 Tax=Enterobact... 141 7e-33 >UniRef50_P76118 Uncharacterized protein yncH n=32 Tax=Enterobacteriaceae RepID=YNCH_ECOLI Length = 70 Score = 141 bits (355), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI 60 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI Sbjct: 1 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI 60 Query: 61 NTNKNIRQVC 70 NTNKNIRQVC Sbjct: 61 NTNKNIRQVC 70 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P76118 Uncharacterized protein yncH n=32 Tax=Enterobact... 99 4e-20 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P76118 Uncharacterized protein yncH n=32 Tax=Enterobacteriaceae RepID=YNCH_ECOLI Length = 70 Score = 98.9 bits (245), Expect = 4e-20, Method: Composition-based stats. Identities = 70/70 (100%), Positives = 70/70 (100%) Query: 1 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI 60 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI Sbjct: 1 MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAINI 60 Query: 61 NTNKNIRQVC 70 NTNKNIRQVC Sbjct: 61 NTNKNIRQVC 70 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.338 0.146 0.425 Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 326,537,472 Number of Sequences: 3077464 Number of extensions: 12988683 Number of successful extensions: 57807 Number of sequences better than 1.0e-01: 1 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 57805 Number of HSP's gapped (non-prelim): 2 length of query: 70 length of database: 1,040,396,356 effective HSP length: 42 effective length of query: 28 effective length of database: 911,142,868 effective search space: 25512000304 effective search space used: 25512000304 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 87 (37.9 bits)