BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (30 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P24244 Uncharacterized protein yccB n=12 Tax=Enterobact... 59 4e-08 UniRef50_C0Q340 Putative periplasmic protein n=7 Tax=cellular or... 51 1e-05 >UniRef50_P24244 Uncharacterized protein yccB n=12 Tax=Enterobacteriaceae RepID=YCCB_ECOLI Length = 30 Score = 58.9 bits (141), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS Sbjct: 1 MWYLLWFVGILLMCSLSTLVLVWLDPRLKS 30 >UniRef50_C0Q340 Putative periplasmic protein n=7 Tax=cellular organisms RepID=C0Q340_SALPC Length = 29 Score = 50.8 bits (120), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 25/29 (86%), Positives = 27/29 (93%) Query: 1 MWYLLWFVGILLMCSLSTLVLVWLDPRLK 29 MWYLLWFVGILLMCSLSTLVLVWL+ R + Sbjct: 1 MWYLLWFVGILLMCSLSTLVLVWLESRQQ 29 Searching..................................................done ***** No hits found ****** Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.337 0.154 0.580 Lambda K H 0.267 0.0460 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 142,780,895 Number of Sequences: 3077464 Number of extensions: 2494394 Number of successful extensions: 18840 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18835 Number of HSP's gapped (non-prelim): 5 length of query: 30 length of database: 1,040,396,356 effective HSP length: 5 effective length of query: 25 effective length of database: 1,025,009,036 effective search space: 25625225900 effective search space used: 25625225900 T: 11 A: 40 X1: 16 ( 7.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 87 (38.0 bits)