BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (49 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0AAX1 Uncharacterized protein ybhT n=129 Tax=Enterobac... 97 2e-19 UniRef50_D2TPG6 Putative membrane protein n=11 Tax=Enterobacteri... 89 5e-17 UniRef50_Q7N6R6 Similar to unknown protein YbhT of Escherichia c... 57 2e-07 UniRef50_B4EST6 Putative membrane protein n=6 Tax=Enterobacteria... 54 1e-06 UniRef50_C4K5R8 Putative uncharacterized protein n=1 Tax=Candida... 50 2e-05 >UniRef50_P0AAX1 Uncharacterized protein ybhT n=129 Tax=Enterobacteriaceae RepID=YBHT_ECO57 Length = 49 Score = 96.7 bits (239), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH Sbjct: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 >UniRef50_D2TPG6 Putative membrane protein n=11 Tax=Enterobacteriaceae RepID=D2TPG6_CITRO Length = 83 Score = 89.0 bits (219), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 43/49 (87%), Positives = 47/49 (95%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFN+FSG+G+KD+ QNH Sbjct: 35 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNLFSGIGQKDRSRQNH 83 >UniRef50_Q7N6R6 Similar to unknown protein YbhT of Escherichia coli n=3 Tax=Enterobacteriaceae RepID=Q7N6R6_PHOLL Length = 44 Score = 57.0 bits (136), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/44 (61%), Positives = 36/44 (81%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQ 44 M EL+KS+ FA++MVPVV ILGLIYGLGE+FNI S +G+ ++ Sbjct: 1 MFELIKSMAFALVMVPVVTVGILGLIYGLGELFNIVSRIGRSEK 44 >UniRef50_B4EST6 Putative membrane protein n=6 Tax=Enterobacteriaceae RepID=B4EST6_PROMH Length = 47 Score = 54.3 bits (129), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/37 (70%), Positives = 33/37 (89%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFS 37 M ELLKSL FA++MVPVVM +I+G+IYGLGE+FN+ S Sbjct: 1 MFELLKSLGFALLMVPVVMVLIMGIIYGLGEIFNLIS 37 >UniRef50_C4K5R8 Putative uncharacterized protein n=1 Tax=Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) RepID=C4K5R8_HAMD5 Length = 49 Score = 50.1 bits (118), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQ 47 M ELLKS +FA++MVPV++ +IL LIYG G++FN+ S K D Sbjct: 4 MFELLKSFLFALLMVPVMITMILSLIYGFGKIFNLIS--HKNDHSSS 48 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_D2TPG6 Putative membrane protein n=11 Tax=Enterobacteri... 72 7e-12 UniRef50_P0AAX1 Uncharacterized protein ybhT n=129 Tax=Enterobac... 61 9e-09 UniRef50_Q7N6R6 Similar to unknown protein YbhT of Escherichia c... 51 1e-05 UniRef50_B4EST6 Putative membrane protein n=6 Tax=Enterobacteria... 47 2e-04 UniRef50_C4K5R8 Putative uncharacterized protein n=1 Tax=Candida... 44 0.002 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_D2TPG6 Putative membrane protein n=11 Tax=Enterobacteriaceae RepID=D2TPG6_CITRO Length = 83 Score = 71.8 bits (175), Expect = 7e-12, Method: Composition-based stats. Identities = 43/49 (87%), Positives = 47/49 (95%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFN+FSG+G+KD+ QNH Sbjct: 35 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNLFSGIGQKDRSRQNH 83 >UniRef50_P0AAX1 Uncharacterized protein ybhT n=129 Tax=Enterobacteriaceae RepID=YBHT_ECO57 Length = 49 Score = 61.4 bits (148), Expect = 9e-09, Method: Composition-based stats. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH Sbjct: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQNH 49 >UniRef50_Q7N6R6 Similar to unknown protein YbhT of Escherichia coli n=3 Tax=Enterobacteriaceae RepID=Q7N6R6_PHOLL Length = 44 Score = 51.0 bits (121), Expect = 1e-05, Method: Composition-based stats. Identities = 27/44 (61%), Positives = 36/44 (81%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQ 44 M EL+KS+ FA++MVPVV ILGLIYGLGE+FNI S +G+ ++ Sbjct: 1 MFELIKSMAFALVMVPVVTVGILGLIYGLGELFNIVSRIGRSEK 44 >UniRef50_B4EST6 Putative membrane protein n=6 Tax=Enterobacteriaceae RepID=B4EST6_PROMH Length = 47 Score = 46.8 bits (110), Expect = 2e-04, Method: Composition-based stats. Identities = 26/37 (70%), Positives = 33/37 (89%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFS 37 M ELLKSL FA++MVPVVM +I+G+IYGLGE+FN+ S Sbjct: 1 MFELLKSLGFALLMVPVVMVLIMGIIYGLGEIFNLIS 37 >UniRef50_C4K5R8 Putative uncharacterized protein n=1 Tax=Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum) RepID=C4K5R8_HAMD5 Length = 49 Score = 43.7 bits (102), Expect = 0.002, Method: Composition-based stats. Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Query: 1 MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQPGQ 47 M ELLKS +FA++MVPV++ +IL LIYG G++FN+ S K D Sbjct: 4 MFELLKSFLFALLMVPVMITMILSLIYGFGKIFNLIS--HKNDHSSS 48 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.333 0.154 0.427 Lambda K H 0.267 0.0468 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 186,382,879 Number of Sequences: 3077464 Number of extensions: 5081165 Number of successful extensions: 34245 Number of sequences better than 1.0e-01: 5 Number of HSP's better than 0.1 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 34235 Number of HSP's gapped (non-prelim): 10 length of query: 49 length of database: 1,040,396,356 effective HSP length: 22 effective length of query: 27 effective length of database: 972,692,148 effective search space: 26262687996 effective search space used: 26262687996 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 88 (38.3 bits)