BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (72 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P58034 Uncharacterized protein ymgF n=35 Tax=Enterobact... 140 1e-32 UniRef50_B7LSL3 Putative uncharacterized protein ymgF n=1 Tax=Es... 57 3e-07 >UniRef50_P58034 Uncharacterized protein ymgF n=35 Tax=Enterobacteriaceae RepID=YMGF_ECOLI Length = 72 Score = 140 bits (353), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR Sbjct: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 Query: 61 LRERLVNHRDQQ 72 LRERLVNHRDQQ Sbjct: 61 LRERLVNHRDQQ 72 >UniRef50_B7LSL3 Putative uncharacterized protein ymgF n=1 Tax=Escherichia fergusonii ATCC 35469 RepID=B7LSL3_ESCF3 Length = 86 Score = 56.6 bits (135), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Query: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 MN + LD LY I S F+++T LVIL + LV +N +NA++W INL+NR Sbjct: 6 MNKNKPLDIVRLYAIISAFFIILTFLVILFGAHGSWFANFLVVVNFINAVMWFLINLINR 65 Query: 61 LRERLVNHRDQQ 72 LR +L H+D + Sbjct: 66 LRMKLA-HKDYR 76 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_B7LSL3 Putative uncharacterized protein ymgF n=1 Tax=Es... 81 2e-14 UniRef50_P58034 Uncharacterized protein ymgF n=35 Tax=Enterobact... 77 2e-13 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_B7LSL3 Putative uncharacterized protein ymgF n=1 Tax=Escherichia fergusonii ATCC 35469 RepID=B7LSL3_ESCF3 Length = 86 Score = 80.7 bits (198), Expect = 2e-14, Method: Composition-based stats. Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Query: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 MN + LD LY I S F+++T LVIL + LV +N +NA++W INL+NR Sbjct: 6 MNKNKPLDIVRLYAIISAFFIILTFLVILFGAHGSWFANFLVVVNFINAVMWFLINLINR 65 Query: 61 LRERLVNHRDQQ 72 LR +L H+D + Sbjct: 66 LRMKLA-HKDYR 76 >UniRef50_P58034 Uncharacterized protein ymgF n=35 Tax=Enterobacteriaceae RepID=YMGF_ECOLI Length = 72 Score = 76.8 bits (188), Expect = 2e-13, Method: Composition-based stats. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR Sbjct: 1 MNNSNNLDYFTLYIIFSIAFMLITLLVILIAKPSTGLGEVLVTINLLNALVWLAINLVNR 60 Query: 61 LRERLVNHRDQQ 72 LRERLVNHRDQQ Sbjct: 61 LRERLVNHRDQQ 72 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.336 0.154 0.439 Lambda K H 0.267 0.0470 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 292,514,544 Number of Sequences: 3077464 Number of extensions: 9275273 Number of successful extensions: 47312 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47308 Number of HSP's gapped (non-prelim): 4 length of query: 72 length of database: 1,040,396,356 effective HSP length: 43 effective length of query: 29 effective length of database: 908,065,404 effective search space: 26333896716 effective search space used: 26333896716 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.1 bits) S2: 88 (38.3 bits)