BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (82 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P75994 Uncharacterized protein ymgC n=35 Tax=Enterobact... 167 8e-41 UniRef50_C4X5R2 Putative uncharacterized protein n=4 Tax=Klebsie... 47 1e-04 >UniRef50_P75994 Uncharacterized protein ymgC n=35 Tax=Enterobacteriaceae RepID=YMGC_ECOLI Length = 82 Score = 167 bits (424), Expect = 8e-41, Method: Compositional matrix adjust. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ 60 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ Sbjct: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ 60 Query: 61 YIEMHKTTLTDIIINDRESVLS 82 YIEMHKTTLTDIIINDRESVLS Sbjct: 61 YIEMHKTTLTDIIINDRESVLS 82 >UniRef50_C4X5R2 Putative uncharacterized protein n=4 Tax=Klebsiella RepID=C4X5R2_KLEPN Length = 121 Score = 47.4 bits (111), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 37/59 (62%) Query: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQIL 59 + N+IP F+F AL KN+E + H V++ + ++ RL+ E++ ILSDLYLQ L Sbjct: 54 IKNTIPAEFVFNSALMKNIENTLIKQHRTVNNERMITEIQHRLQTESNEILSDLYLQAL 112 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P75994 Uncharacterized protein ymgC n=35 Tax=Enterobact... 122 3e-27 UniRef50_C4X5R2 Putative uncharacterized protein n=4 Tax=Klebsie... 92 6e-18 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P75994 Uncharacterized protein ymgC n=35 Tax=Enterobacteriaceae RepID=YMGC_ECOLI Length = 82 Score = 122 bits (307), Expect = 3e-27, Method: Composition-based stats. Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ 60 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ Sbjct: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ 60 Query: 61 YIEMHKTTLTDIIINDRESVLS 82 YIEMHKTTLTDIIINDRESVLS Sbjct: 61 YIEMHKTTLTDIIINDRESVLS 82 >UniRef50_C4X5R2 Putative uncharacterized protein n=4 Tax=Klebsiella RepID=C4X5R2_KLEPN Length = 121 Score = 91.6 bits (226), Expect = 6e-18, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 38/62 (61%) Query: 1 MNNSIPERFIFQCALFKNLEREVFMTHGYVDSHIIDQALRLRLKDETSVILSDLYLQILQ 60 + N+IP F+F AL KN+E + H V++ + ++ RL+ E++ ILSDLYLQ L Sbjct: 54 IKNTIPAEFVFNSALMKNIENTLIKQHRTVNNERMITEIQHRLQTESNEILSDLYLQALD 113 Query: 61 YI 62 + Sbjct: 114 ML 115 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.319 0.137 0.352 Lambda K H 0.267 0.0425 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 286,327,688 Number of Sequences: 3077464 Number of extensions: 8395192 Number of successful extensions: 29780 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 29776 Number of HSP's gapped (non-prelim): 4 length of query: 82 length of database: 1,040,396,356 effective HSP length: 53 effective length of query: 29 effective length of database: 877,290,764 effective search space: 25441432156 effective search space used: 25441432156 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 87 (38.1 bits)