BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (78 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P52134 Uncharacterized protein ypjK n=4 Tax=Escherichia... 140 1e-32 UniRef50_D0KKQ7 CP4-57 prophage; inner membrane protein n=2 Tax=... 84 1e-15 >UniRef50_P52134 Uncharacterized protein ypjK n=4 Tax=Escherichia coli RepID=YPJK_ECOLI Length = 78 Score = 140 bits (353), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI Sbjct: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 Query: 61 FVGIYVFAKVVRLISGKK 78 FVGIYVFAKVVRLISGKK Sbjct: 61 FVGIYVFAKVVRLISGKK 78 >UniRef50_D0KKQ7 CP4-57 prophage; inner membrane protein n=2 Tax=Pectobacterium RepID=D0KKQ7_PECWW Length = 77 Score = 84.0 bits (206), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 52/77 (67%), Positives = 65/77 (84%) Query: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 MP+IAII IV++VI+L+KTG+SDSL L +ATVA LLTG G AG ASVALTPF+GVP+G+ Sbjct: 1 MPIIAIIVIVVVVIVLSKTGISDSLIGLVIATVAGLLTGSGTAGVASVALTPFLGVPIGL 60 Query: 61 FVGIYVFAKVVRLISGK 77 FVG+ VFAKV+R S + Sbjct: 61 FVGVTVFAKVLRWFSRR 77 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P52134 Uncharacterized protein ypjK n=4 Tax=Escherichia... 70 2e-11 UniRef50_D0KKQ7 CP4-57 prophage; inner membrane protein n=2 Tax=... 70 3e-11 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P52134 Uncharacterized protein ypjK n=4 Tax=Escherichia coli RepID=YPJK_ECOLI Length = 78 Score = 70.3 bits (171), Expect = 2e-11, Method: Composition-based stats. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI Sbjct: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 Query: 61 FVGIYVFAKVVRLISGKK 78 FVGIYVFAKVVRLISGKK Sbjct: 61 FVGIYVFAKVVRLISGKK 78 >UniRef50_D0KKQ7 CP4-57 prophage; inner membrane protein n=2 Tax=Pectobacterium RepID=D0KKQ7_PECWW Length = 77 Score = 69.5 bits (169), Expect = 3e-11, Method: Composition-based stats. Identities = 52/77 (67%), Positives = 65/77 (84%) Query: 1 MPVIAIIAIVIIVIILNKTGVSDSLTALTLATVAALLTGGGAAGAASVALTPFVGVPVGI 60 MP+IAII IV++VI+L+KTG+SDSL L +ATVA LLTG G AG ASVALTPF+GVP+G+ Sbjct: 1 MPIIAIIVIVVVVIVLSKTGISDSLIGLVIATVAGLLTGSGTAGVASVALTPFLGVPIGL 60 Query: 61 FVGIYVFAKVVRLISGK 77 FVG+ VFAKV+R S + Sbjct: 61 FVGVTVFAKVLRWFSRR 77 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.328 0.152 0.428 Lambda K H 0.267 0.0483 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 308,234,934 Number of Sequences: 3077464 Number of extensions: 12122424 Number of successful extensions: 113464 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 113453 Number of HSP's gapped (non-prelim): 10 length of query: 78 length of database: 1,040,396,356 effective HSP length: 49 effective length of query: 29 effective length of database: 889,600,620 effective search space: 25798417980 effective search space used: 25798417980 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 88 (38.3 bits)