BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (60 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P64498 Protein yoaG n=84 Tax=Enterobacteriaceae RepID=Y... 122 4e-27 UniRef50_B4ET66 Putative uncharacterized protein n=9 Tax=Enterob... 62 8e-09 UniRef50_C6DD21 Putative uncharacterized protein n=7 Tax=Enterob... 60 3e-08 UniRef50_Q6D753 Putative uncharacterized protein n=1 Tax=Pectoba... 57 1e-07 >UniRef50_P64498 Protein yoaG n=84 Tax=Enterobacteriaceae RepID=YOAG_ECO57 Length = 60 Score = 122 bits (306), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW Sbjct: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 >UniRef50_B4ET66 Putative uncharacterized protein n=9 Tax=Enterobacteriaceae RepID=B4ET66_PROMH Length = 112 Score = 61.6 bits (148), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 + T+T+TN +NGVSVD E E LL P++A+ ++KDL+N VR YD + E +VCGW Sbjct: 54 LSAQALTLTLTNKNNGVSVDKECEIK-DLLDPDMASLMVKDLINIVRGYDMDEEANVCGW 112 >UniRef50_C6DD21 Putative uncharacterized protein n=7 Tax=Enterobacteriaceae RepID=C6DD21_PECCP Length = 112 Score = 59.7 bits (143), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 29/58 (50%), Positives = 39/58 (67%) Query: 3 KATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 K + +TVTNN+NGVSVD + T L ++AE +K+LVN VR YD + E +VCGW Sbjct: 55 KKGFLLTVTNNNNGVSVDKDLPTVEELKDKTISAEAVKELVNIVRGYDADEETNVCGW 112 >UniRef50_Q6D753 Putative uncharacterized protein n=1 Tax=Pectobacterium atrosepticum RepID=Q6D753_ERWCT Length = 84 Score = 57.4 bits (137), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 27/55 (49%), Positives = 37/55 (67%) Query: 6 YTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 + +TVTNN+NGVSVD + L ++AE +K+LVN VR YD + E +VCGW Sbjct: 30 FLLTVTNNNNGVSVDKDFSALAELKDKTISAESVKELVNIVRGYDADEETNVCGW 84 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C6DD21 Putative uncharacterized protein n=7 Tax=Enterob... 89 5e-17 UniRef50_B4ET66 Putative uncharacterized protein n=9 Tax=Enterob... 84 1e-15 UniRef50_P64498 Protein yoaG n=84 Tax=Enterobacteriaceae RepID=Y... 83 3e-15 UniRef50_Q6D753 Putative uncharacterized protein n=1 Tax=Pectoba... 82 5e-15 Sequences not found previously or not previously below threshold: UniRef50_B5XW41 Putative uncharacterized protein n=5 Tax=Klebsie... 40 0.027 CONVERGED! >UniRef50_C6DD21 Putative uncharacterized protein n=7 Tax=Enterobacteriaceae RepID=C6DD21_PECCP Length = 112 Score = 88.6 bits (218), Expect = 5e-17, Method: Composition-based stats. Identities = 29/59 (49%), Positives = 39/59 (66%) Query: 2 GKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 K + +TVTNN+NGVSVD + T L ++AE +K+LVN VR YD + E +VCGW Sbjct: 54 NKKGFLLTVTNNNNGVSVDKDLPTVEELKDKTISAEAVKELVNIVRGYDADEETNVCGW 112 >UniRef50_B4ET66 Putative uncharacterized protein n=9 Tax=Enterobacteriaceae RepID=B4ET66_PROMH Length = 112 Score = 84.4 bits (207), Expect = 1e-15, Method: Composition-based stats. Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 + T+T+TN +NGVSVD E E LL P++A+ ++KDL+N VR YD + E +VCGW Sbjct: 54 LSAQALTLTLTNKNNGVSVDKECEIK-DLLDPDMASLMVKDLINIVRGYDMDEEANVCGW 112 >UniRef50_P64498 Protein yoaG n=84 Tax=Enterobacteriaceae RepID=YOAG_ECO57 Length = 60 Score = 82.8 bits (203), Expect = 3e-15, Method: Composition-based stats. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW Sbjct: 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 >UniRef50_Q6D753 Putative uncharacterized protein n=1 Tax=Pectobacterium atrosepticum RepID=Q6D753_ERWCT Length = 84 Score = 82.1 bits (201), Expect = 5e-15, Method: Composition-based stats. Identities = 27/56 (48%), Positives = 37/56 (66%) Query: 5 TYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 + +TVTNN+NGVSVD + L ++AE +K+LVN VR YD + E +VCGW Sbjct: 29 GFLLTVTNNNNGVSVDKDFSALAELKDKTISAESVKELVNIVRGYDADEETNVCGW 84 >UniRef50_B5XW41 Putative uncharacterized protein n=5 Tax=Klebsiella RepID=B5XW41_KLEP3 Length = 109 Score = 39.7 bits (91), Expect = 0.027, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 25/56 (44%) Query: 2 GKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDV 57 GK ++++TN ++G+SV+ P +K +V V Y+ E + Sbjct: 52 GKQEISLSLTNAASGISVELHHPASGESATPAFIEGELKKIVQIVDGYEAAEETHI 107 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.315 0.131 0.365 Lambda K H 0.267 0.0411 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 205,222,098 Number of Sequences: 3077464 Number of extensions: 5292582 Number of successful extensions: 14631 Number of sequences better than 1.0e-01: 5 Number of HSP's better than 0.1 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14616 Number of HSP's gapped (non-prelim): 13 length of query: 60 length of database: 1,040,396,356 effective HSP length: 32 effective length of query: 28 effective length of database: 941,917,508 effective search space: 26373690224 effective search space used: 26373690224 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 87 (38.1 bits)