BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (101 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P76163 Uncharacterized protein ydfV n=5 Tax=Enterobacte... 206 2e-52 >UniRef50_P76163 Uncharacterized protein ydfV n=5 Tax=Enterobacteriaceae RepID=YDFV_ECOLI Length = 101 Score = 206 bits (524), Expect = 2e-52, Method: Compositional matrix adjust. Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT 60 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT Sbjct: 1 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT 60 Query: 61 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR 101 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR Sbjct: 61 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR 101 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P76163 Uncharacterized protein ydfV n=5 Tax=Enterobacte... 181 5e-45 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P76163 Uncharacterized protein ydfV n=5 Tax=Enterobacteriaceae RepID=YDFV_ECOLI Length = 101 Score = 181 bits (460), Expect = 5e-45, Method: Composition-based stats. Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT 60 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT Sbjct: 1 MSLQVSHYNMLRASHEGSQKVVVRTVITVRFVPGAAIAKSILYCAGQLVFKESGHHLTGT 60 Query: 61 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR 101 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR Sbjct: 61 DTIYFVTVRLHMHNSTYSSIFCFSMSVLLSRRRVSGDLTCR 101 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.328 0.134 0.396 Lambda K H 0.267 0.0435 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 420,487,231 Number of Sequences: 3077464 Number of extensions: 15726376 Number of successful extensions: 38180 Number of sequences better than 1.0e-01: 1 Number of HSP's better than 0.1 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 38178 Number of HSP's gapped (non-prelim): 2 length of query: 101 length of database: 1,040,396,356 effective HSP length: 70 effective length of query: 31 effective length of database: 824,973,876 effective search space: 25574190156 effective search space used: 25574190156 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 87 (38.0 bits)