BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (179 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P11865 Uncharacterized protein yhaB n=42 Tax=Enterobact... 374 e-103 UniRef50_Q8FDC0 Putative uncharacterized protein n=2 Tax=Escheri... 63 4e-09 UniRef50_B1EF36 Putative uncharacterized protein n=1 Tax=Escheri... 41 0.014 >UniRef50_P11865 Uncharacterized protein yhaB n=42 Tax=Enterobacteriaceae RepID=YHAB_ECOLI Length = 179 Score = 374 bits (960), Expect = e-103, Method: Compositional matrix adjust. Identities = 179/179 (100%), Positives = 179/179 (100%) Query: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL 60 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL Sbjct: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL 60 Query: 61 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS 120 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS Sbjct: 61 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS 120 Query: 121 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY 179 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY Sbjct: 121 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY 179 >UniRef50_Q8FDC0 Putative uncharacterized protein n=2 Tax=Escherichia coli RepID=Q8FDC0_ECOL6 Length = 42 Score = 63.2 bits (152), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Query: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVK 34 MKGF IAHIFHPS MHAVVNNHNRNIDYWTVK Sbjct: 11 MKGFSIAHIFHPS---MHAVVNNHNRNIDYWTVK 41 >UniRef50_B1EF36 Putative uncharacterized protein n=1 Tax=Escherichia albertii TW07627 RepID=B1EF36_9ESCH Length = 62 Score = 41.2 bits (95), Expect = 0.014, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 25/39 (64%) Query: 8 HIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDV 46 H S PPM N+N+ IDYW+VK KFAEI+S DV Sbjct: 6 HFSDRSPPPMQTHSYNNNKVIDYWSVKIKFAEIISAYDV 44 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P11865 Uncharacterized protein yhaB n=42 Tax=Enterobact... 375 e-103 UniRef50_Q8FDC0 Putative uncharacterized protein n=2 Tax=Escheri... 65 1e-09 Sequences not found previously or not previously below threshold: UniRef50_B1EF36 Putative uncharacterized protein n=1 Tax=Escheri... 42 0.007 CONVERGED! >UniRef50_P11865 Uncharacterized protein yhaB n=42 Tax=Enterobacteriaceae RepID=YHAB_ECOLI Length = 179 Score = 375 bits (963), Expect = e-103, Method: Composition-based stats. Identities = 179/179 (100%), Positives = 179/179 (100%) Query: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL 60 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL Sbjct: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDVNKIYSISNELRRVL 60 Query: 61 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS 120 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS Sbjct: 61 SAITALNFYHGDVPSVMIRIQPENMSPFIIDISTGEHDDYIIQTLDVGTFAPFGEQCTCS 120 Query: 121 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY 179 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY Sbjct: 121 AVNKKELECIKETISKYCAKFTRKEAILTPLVHFNKTSITSDCWQILFFSPDHFNNDFY 179 >UniRef50_Q8FDC0 Putative uncharacterized protein n=2 Tax=Escherichia coli RepID=Q8FDC0_ECOL6 Length = 42 Score = 64.7 bits (156), Expect = 1e-09, Method: Composition-based stats. Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Query: 1 MKGFPIAHIFHPSIPPMHAVVNNHNRNIDYWTVK 34 MKGF IAHIFHPS MHAVVNNHNRNIDYWTVK Sbjct: 11 MKGFSIAHIFHPS---MHAVVNNHNRNIDYWTVK 41 >UniRef50_B1EF36 Putative uncharacterized protein n=1 Tax=Escherichia albertii TW07627 RepID=B1EF36_9ESCH Length = 62 Score = 42.3 bits (98), Expect = 0.007, Method: Composition-based stats. Identities = 21/39 (53%), Positives = 25/39 (64%) Query: 8 HIFHPSIPPMHAVVNNHNRNIDYWTVKRKFAEIVSTNDV 46 H S PPM N+N+ IDYW+VK KFAEI+S DV Sbjct: 6 HFSDRSPPPMQTHSYNNNKVIDYWSVKIKFAEIISAYDV 44 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.321 0.136 0.423 Lambda K H 0.267 0.0424 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 821,237,260 Number of Sequences: 3077464 Number of extensions: 33747782 Number of successful extensions: 78789 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 78781 Number of HSP's gapped (non-prelim): 6 length of query: 179 length of database: 1,040,396,356 effective HSP length: 120 effective length of query: 59 effective length of database: 671,100,676 effective search space: 39594939884 effective search space used: 39594939884 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 89 (38.8 bits)