BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (35 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_B7LTE2 Small toxic polypeptide ldrD (Modular protein) n... 50 2e-05 UniRef50_Q6BF25 Small toxic polypeptide ldrD n=124 Tax=Enterobac... 48 8e-05 >UniRef50_B7LTE2 Small toxic polypeptide ldrD (Modular protein) n=10 Tax=Enterobacteriaceae RepID=B7LTE2_ESCF3 Length = 83 Score = 50.4 bits (119), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 27/35 (77%) Query: 1 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK 35 MTLA+ M FWHDLAAP++AGI+ + IV+W RK Sbjct: 49 MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK 83 >UniRef50_Q6BF25 Small toxic polypeptide ldrD n=124 Tax=Enterobacteriaceae RepID=LDRD_ECOLI Length = 35 Score = 48.1 bits (113), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 20/35 (57%), Positives = 26/35 (74%) Query: 1 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK 35 MT A+ M FWHDLAAP++AGI+ + IV+W RK Sbjct: 1 MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK 35 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_B7LTE2 Small toxic polypeptide ldrD (Modular protein) n... 57 2e-07 UniRef50_Q6BF25 Small toxic polypeptide ldrD n=124 Tax=Enterobac... 45 6e-04 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_B7LTE2 Small toxic polypeptide ldrD (Modular protein) n=10 Tax=Enterobacteriaceae RepID=B7LTE2_ESCF3 Length = 83 Score = 56.9 bits (136), Expect = 2e-07, Method: Composition-based stats. Identities = 21/35 (60%), Positives = 27/35 (77%) Query: 1 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK 35 MTLA+ M FWHDLAAP++AGI+ + IV+W RK Sbjct: 49 MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK 83 >UniRef50_Q6BF25 Small toxic polypeptide ldrD n=124 Tax=Enterobacteriaceae RepID=LDRD_ECOLI Length = 35 Score = 45.3 bits (106), Expect = 6e-04, Method: Composition-based stats. Identities = 20/35 (57%), Positives = 26/35 (74%) Query: 1 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK 35 MT A+ M FWHDLAAP++AGI+ + IV+W RK Sbjct: 1 MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK 35 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.334 0.145 0.498 Lambda K H 0.267 0.0427 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 148,803,693 Number of Sequences: 3077464 Number of extensions: 2848659 Number of successful extensions: 22095 Number of sequences better than 1.0e-01: 3 Number of HSP's better than 0.1 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 22089 Number of HSP's gapped (non-prelim): 6 length of query: 35 length of database: 1,040,396,356 effective HSP length: 9 effective length of query: 26 effective length of database: 1,012,699,180 effective search space: 26330178680 effective search space used: 26330178680 T: 11 A: 40 X1: 16 ( 7.7 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 87 (38.1 bits)