BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (46 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_A7MFN6 50S ribosomal protein L36 2 n=3 Tax=Enterobacter... 49 5e-05 UniRef50_A6V1J0 50S ribosomal protein L36 2 n=397 Tax=cellular o... 46 3e-04 UniRef50_B2S7H9 50S ribosomal protein L36 n=44 Tax=Bacteria RepI... 43 0.003 UniRef50_Q2GKJ8 50S ribosomal protein L36 n=12 Tax=Bacteria RepI... 42 0.008 UniRef50_Q1QP05 50S ribosomal protein L36 n=77 Tax=cellular orga... 41 0.014 UniRef50_B9W7Q5 Ribosomal protein L36 n=8 Tax=Saccharomycetales ... 40 0.033 UniRef50_B9SET5 Ribosomal protein L36 n=1 Tax=Ricinus communis R... 38 0.063 >UniRef50_A7MFN6 50S ribosomal protein L36 2 n=3 Tax=Enterobacteriaceae RepID=RL362_ENTS8 Length = 46 Score = 48.8 bits (115), Expect = 5e-05, Method: Composition-based stats. Identities = 39/46 (84%), Positives = 45/46 (97%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR 46 M+VLNSLR+AK RHPDCQIV+RKGRLYVICK+NPRFKAVQGRKK++ Sbjct: 1 MQVLNSLRSAKARHPDCQIVRRKGRLYVICKTNPRFKAVQGRKKRK 46 >UniRef50_A6V1J0 50S ribosomal protein L36 2 n=397 Tax=cellular organisms RepID=RL362_PSEA7 Length = 50 Score = 46.1 bits (108), Expect = 3e-04, Method: Composition-based stats. Identities = 35/46 (76%), Positives = 39/46 (84%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR 46 MKVL SL+ AK RH DCQ+VKR+GRLYVICKSNPRFK VQGR K + Sbjct: 1 MKVLASLKQAKLRHRDCQVVKRRGRLYVICKSNPRFKCVQGRPKPK 46 >UniRef50_B2S7H9 50S ribosomal protein L36 n=44 Tax=Bacteria RepID=RL36_BRUA1 Length = 41 Score = 42.7 bits (99), Expect = 0.003, Method: Composition-based stats. Identities = 26/41 (63%), Positives = 33/41 (80%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MK+ NSL+ K RH DCQ+V+RKGR+Y+I K+ PRFKA QG Sbjct: 1 MKIKNSLKALKARHRDCQLVRRKGRVYIINKTAPRFKARQG 41 >UniRef50_Q2GKJ8 50S ribosomal protein L36 n=12 Tax=Bacteria RepID=RL36_ANAPZ Length = 42 Score = 41.5 bits (96), Expect = 0.008, Method: Composition-based stats. Identities = 27/41 (65%), Positives = 33/41 (80%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MKV+ SL++AK R DC+IV+RKGR+YVI K PRFKA QG Sbjct: 1 MKVMGSLKSAKSRDRDCKIVRRKGRVYVINKKKPRFKARQG 41 >UniRef50_Q1QP05 50S ribosomal protein L36 n=77 Tax=cellular organisms RepID=RL36_NITHX Length = 41 Score = 40.8 bits (94), Expect = 0.014, Method: Composition-based stats. Identities = 24/41 (58%), Positives = 32/41 (78%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MKV NSL++ + RH D ++V+RKGR+YVI K+ RFKA QG Sbjct: 1 MKVRNSLKSLRARHRDNRLVRRKGRVYVINKTQRRFKARQG 41 >UniRef50_B9W7Q5 Ribosomal protein L36 n=8 Tax=Saccharomycetales RepID=B9W7Q5_CANDC Length = 125 Score = 39.6 bits (91), Expect = 0.033, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 22/33 (66%) Query: 9 TAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 + K DC +VKRKGR+YV CKSN + K QG Sbjct: 93 SVKCMCKDCYLVKRKGRVYVYCKSNGKHKQRQG 125 >UniRef50_B9SET5 Ribosomal protein L36 n=1 Tax=Ricinus communis RepID=B9SET5_RICCO Length = 84 Score = 38.4 bits (88), Expect = 0.063, Method: Composition-based stats. Identities = 23/41 (56%), Positives = 29/41 (70%), Gaps = 3/41 (7%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MKV +S++ E CQIVKR+GR+YVIC SNP+ K QG Sbjct: 4 MKVRSSVKKMCEF---CQIVKRRGRVYVICNSNPKHKQRQG 41 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_A7MFN6 50S ribosomal protein L36 2 n=3 Tax=Enterobacter... 57 1e-07 UniRef50_A6V1J0 50S ribosomal protein L36 2 n=397 Tax=cellular o... 54 2e-06 Sequences not found previously or not previously below threshold: UniRef50_B2S7H9 50S ribosomal protein L36 n=44 Tax=Bacteria RepI... 40 0.016 UniRef50_Q2GKJ8 50S ribosomal protein L36 n=12 Tax=Bacteria RepI... 38 0.086 CONVERGED! >UniRef50_A7MFN6 50S ribosomal protein L36 2 n=3 Tax=Enterobacteriaceae RepID=RL362_ENTS8 Length = 46 Score = 57.3 bits (137), Expect = 1e-07, Method: Composition-based stats. Identities = 39/46 (84%), Positives = 45/46 (97%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR 46 M+VLNSLR+AK RHPDCQIV+RKGRLYVICK+NPRFKAVQGRKK++ Sbjct: 1 MQVLNSLRSAKARHPDCQIVRRKGRLYVICKTNPRFKAVQGRKKRK 46 >UniRef50_A6V1J0 50S ribosomal protein L36 2 n=397 Tax=cellular organisms RepID=RL362_PSEA7 Length = 50 Score = 53.8 bits (128), Expect = 2e-06, Method: Composition-based stats. Identities = 35/46 (76%), Positives = 39/46 (84%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR 46 MKVL SL+ AK RH DCQ+VKR+GRLYVICKSNPRFK VQGR K + Sbjct: 1 MKVLASLKQAKLRHRDCQVVKRRGRLYVICKSNPRFKCVQGRPKPK 46 >UniRef50_B2S7H9 50S ribosomal protein L36 n=44 Tax=Bacteria RepID=RL36_BRUA1 Length = 41 Score = 40.4 bits (93), Expect = 0.016, Method: Composition-based stats. Identities = 26/41 (63%), Positives = 33/41 (80%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MK+ NSL+ K RH DCQ+V+RKGR+Y+I K+ PRFKA QG Sbjct: 1 MKIKNSLKALKARHRDCQLVRRKGRVYIINKTAPRFKARQG 41 >UniRef50_Q2GKJ8 50S ribosomal protein L36 n=12 Tax=Bacteria RepID=RL36_ANAPZ Length = 42 Score = 38.1 bits (87), Expect = 0.086, Method: Composition-based stats. Identities = 27/41 (65%), Positives = 33/41 (80%) Query: 1 MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQG 41 MKV+ SL++AK R DC+IV+RKGR+YVI K PRFKA QG Sbjct: 1 MKVMGSLKSAKSRDRDCKIVRRKGRVYVINKKKPRFKARQG 41 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.316 0.140 0.418 Lambda K H 0.267 0.0400 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 169,421,651 Number of Sequences: 3077464 Number of extensions: 3776191 Number of successful extensions: 12163 Number of sequences better than 1.0e-01: 30 Number of HSP's better than 0.1 without gapping: 57 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 12103 Number of HSP's gapped (non-prelim): 68 length of query: 46 length of database: 1,040,396,356 effective HSP length: 20 effective length of query: 26 effective length of database: 978,847,076 effective search space: 25450023976 effective search space used: 25450023976 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 87 (38.2 bits)