BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (46 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2EET0 Putative uncharacterized protein ypdJ n=9 Tax=Es... 100 2e-20 UniRef50_O22010 Excisionase n=13 Tax=root RepID=VXIS_BPSF5 94 1e-18 >UniRef50_Q2EET0 Putative uncharacterized protein ypdJ n=9 Tax=Escherichia coli RepID=YPDJ_ECOLI Length = 46 Score = 100 bits (248), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS Sbjct: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 >UniRef50_O22010 Excisionase n=13 Tax=root RepID=VXIS_BPSF5 Length = 147 Score = 94.0 bits (232), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 42/46 (91%), Positives = 43/46 (93%) Query: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 MGYDSRLD LAATSWYPFFNNVT RGEI+EPYSLTLDEAC FLKIS Sbjct: 4 MGYDSRLDRLAATSWYPFFNNVTARGEIMEPYSLTLDEACDFLKIS 49 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_O22010 Excisionase n=13 Tax=root RepID=VXIS_BPSF5 100 2e-20 UniRef50_Q2EET0 Putative uncharacterized protein ypdJ n=9 Tax=Es... 93 2e-18 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_O22010 Excisionase n=13 Tax=root RepID=VXIS_BPSF5 Length = 147 Score = 99.6 bits (247), Expect = 2e-20, Method: Composition-based stats. Identities = 42/46 (91%), Positives = 43/46 (93%) Query: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 MGYDSRLD LAATSWYPFFNNVT RGEI+EPYSLTLDEAC FLKIS Sbjct: 4 MGYDSRLDRLAATSWYPFFNNVTARGEIMEPYSLTLDEACDFLKIS 49 >UniRef50_Q2EET0 Putative uncharacterized protein ypdJ n=9 Tax=Escherichia coli RepID=YPDJ_ECOLI Length = 46 Score = 93.5 bits (231), Expect = 2e-18, Method: Composition-based stats. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS Sbjct: 1 MGYDSRLDHLAATSWYPFFNNVTTRGEIIEPYSLTLDEACQFLKIS 46 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.318 0.144 0.464 Lambda K H 0.267 0.0441 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 201,047,995 Number of Sequences: 3077464 Number of extensions: 4924160 Number of successful extensions: 10309 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10305 Number of HSP's gapped (non-prelim): 4 length of query: 46 length of database: 1,040,396,356 effective HSP length: 20 effective length of query: 26 effective length of database: 978,847,076 effective search space: 25450023976 effective search space used: 25450023976 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 87 (38.0 bits)