BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (77 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P76073 Uncharacterized protein ynaE n=32 Tax=Enterobact... 156 2e-37 UniRef50_B5Y2P1 Putative uncharacterized protein n=2 Tax=Enterob... 100 2e-20 >UniRef50_P76073 Uncharacterized protein ynaE n=32 Tax=Enterobacteriaceae RepID=YNAE_ECOLI Length = 88 Score = 156 bits (395), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 60 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL Sbjct: 12 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 71 Query: 61 QTAISVLKDNQNLNGKM 77 QTAISVLKDNQNLNGKM Sbjct: 72 QTAISVLKDNQNLNGKM 88 >UniRef50_B5Y2P1 Putative uncharacterized protein n=2 Tax=Enterobacteriaceae RepID=B5Y2P1_KLEP3 Length = 95 Score = 100 bits (249), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 48/76 (63%), Positives = 61/76 (80%) Query: 1 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 60 MKSKDTL W+PAQLP V+IILG+AV+ V KQGRPINTRTLL+Y++ K D+K + Sbjct: 19 MKSKDTLDWYPAQLPPVKIILGEAVLAVGKQGRPINTRTLLEYLQVMQDKQKRRDDKIAM 78 Query: 61 QTAISVLKDNQNLNGK 76 QTAI+VL+DNQ +NG+ Sbjct: 79 QTAINVLRDNQRINGR 94 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P76073 Uncharacterized protein ynaE n=32 Tax=Enterobact... 127 1e-28 UniRef50_B5Y2P1 Putative uncharacterized protein n=2 Tax=Enterob... 125 6e-28 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P76073 Uncharacterized protein ynaE n=32 Tax=Enterobacteriaceae RepID=YNAE_ECOLI Length = 88 Score = 127 bits (320), Expect = 1e-28, Method: Composition-based stats. Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 60 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL Sbjct: 12 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 71 Query: 61 QTAISVLKDNQNLNGKM 77 QTAISVLKDNQNLNGKM Sbjct: 72 QTAISVLKDNQNLNGKM 88 >UniRef50_B5Y2P1 Putative uncharacterized protein n=2 Tax=Enterobacteriaceae RepID=B5Y2P1_KLEP3 Length = 95 Score = 125 bits (313), Expect = 6e-28, Method: Composition-based stats. Identities = 48/76 (63%), Positives = 61/76 (80%) Query: 1 MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL 60 MKSKDTL W+PAQLP V+IILG+AV+ V KQGRPINTRTLL+Y++ K D+K + Sbjct: 19 MKSKDTLDWYPAQLPPVKIILGEAVLAVGKQGRPINTRTLLEYLQVMQDKQKRRDDKIAM 78 Query: 61 QTAISVLKDNQNLNGK 76 QTAI+VL+DNQ +NG+ Sbjct: 79 QTAINVLRDNQRINGR 94 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.315 0.138 0.394 Lambda K H 0.267 0.0396 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 279,889,143 Number of Sequences: 3077464 Number of extensions: 8437835 Number of successful extensions: 18066 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 18062 Number of HSP's gapped (non-prelim): 4 length of query: 77 length of database: 1,040,396,356 effective HSP length: 48 effective length of query: 29 effective length of database: 892,678,084 effective search space: 25887664436 effective search space used: 25887664436 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 87 (38.2 bits)