/bmm/www/servers/phyre2/bin/poing
file: /bmm/www/servers/phyre2/public_html/phyre2_output/980fa99ef97a4804/hh.c1wq6A_.model.1.pdb
MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELLQTAISVLKDNQNLNGKM
CCCHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
-----------------------------------+++++++++---++++++---------++++++++++-----  HHscore 0.420, sequence id 29%  /bmm/www/servers/phyre2/public_html/phyre2_output/980fa99ef97a4804/hh.c1wq6A_.model.1.pdb

0% of protein confidently modelled...
50% or less of protein confidently modelled - using mergeFragments.py
Post-synthesis iterations: 130800
Protein length: 77  of which strand: 0
Estimated time per simulation: 8 minutes
Number of repetitions of folding: 500
Estimated total CPU time: 69 hours
Estimated wallclock time on 100 processors: 0 hours