BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (51 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P0ACW9 Uncharacterized protein ydfA n=108 Tax=Enterobac... 107 1e-22 UniRef50_P0ACW1 Uncharacterized protein ydaF n=14 Tax=Enterobact... 91 9e-18 >UniRef50_P0ACW9 Uncharacterized protein ydfA n=108 Tax=Enterobacteriaceae RepID=YDFA_ECO57 Length = 51 Score = 107 bits (267), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE 51 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE Sbjct: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE 51 >UniRef50_P0ACW1 Uncharacterized protein ydaF n=14 Tax=Enterobacteriaceae RepID=YDAF_ECO57 Length = 51 Score = 91.3 bits (225), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 42/49 (85%), Positives = 45/49 (91%) Query: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS 49 M IDLGNNESLV GVFPNQDGTFTAMTYTKSKTFKTE GARRWLE+++ Sbjct: 1 MQKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT 49 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P0ACW1 Uncharacterized protein ydaF n=14 Tax=Enterobact... 94 2e-18 UniRef50_P0ACW9 Uncharacterized protein ydfA n=108 Tax=Enterobac... 94 2e-18 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P0ACW1 Uncharacterized protein ydaF n=14 Tax=Enterobacteriaceae RepID=YDAF_ECO57 Length = 51 Score = 93.6 bits (231), Expect = 2e-18, Method: Composition-based stats. Identities = 42/49 (85%), Positives = 45/49 (91%) Query: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNS 49 M IDLGNNESLV GVFPNQDGTFTAMTYTKSKTFKTE GARRWLE+++ Sbjct: 1 MQKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT 49 >UniRef50_P0ACW9 Uncharacterized protein ydfA n=108 Tax=Enterobacteriaceae RepID=YDFA_ECO57 Length = 51 Score = 93.6 bits (231), Expect = 2e-18, Method: Composition-based stats. Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE 51 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE Sbjct: 1 MDTIDLGNNESLVYGVFPNQDGTFTAMTYTKSKTFKTENGARRWLERNSGE 51 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.309 0.135 0.400 Lambda K H 0.267 0.0396 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 205,517,425 Number of Sequences: 3077464 Number of extensions: 5422832 Number of successful extensions: 8754 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8750 Number of HSP's gapped (non-prelim): 4 length of query: 51 length of database: 1,040,396,356 effective HSP length: 24 effective length of query: 27 effective length of database: 966,537,220 effective search space: 26096504940 effective search space used: 26096504940 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits) S2: 87 (38.2 bits)