BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (60 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2EER5 Putative uncharacterized protein ymjC n=7 Tax=Es... 105 4e-22 UniRef50_A7ZLF6 NmrA family protein n=51 Tax=Bacteria RepID=A7ZL... 101 8e-21 >UniRef50_Q2EER5 Putative uncharacterized protein ymjC n=7 Tax=Escherichia coli RepID=YMJC_ECOLI Length = 60 Score = 105 bits (263), Expect = 4e-22, Method: Composition-based stats. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR 60 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR Sbjct: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR 60 >UniRef50_A7ZLF6 NmrA family protein n=51 Tax=Bacteria RepID=A7ZLF6_ECO24 Length = 212 Score = 101 bits (251), Expect = 8e-21, Method: Composition-based stats. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN 46 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN Sbjct: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN 46 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_Q2EER5 Putative uncharacterized protein ymjC n=7 Tax=Es... 105 4e-22 UniRef50_A7ZLF6 NmrA family protein n=51 Tax=Bacteria RepID=A7ZL... 101 8e-21 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_Q2EER5 Putative uncharacterized protein ymjC n=7 Tax=Escherichia coli RepID=YMJC_ECOLI Length = 60 Score = 105 bits (263), Expect = 4e-22, Method: Composition-based stats. Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR 60 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR Sbjct: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNKMQTTSGKKVIQDR 60 >UniRef50_A7ZLF6 NmrA family protein n=51 Tax=Bacteria RepID=A7ZLF6_ECO24 Length = 212 Score = 101 bits (251), Expect = 8e-21, Method: Composition-based stats. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN 46 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN Sbjct: 1 MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTN 46 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.318 0.132 0.366 Lambda K H 0.267 0.0404 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 225,561,474 Number of Sequences: 3077464 Number of extensions: 6210194 Number of successful extensions: 15898 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 15894 Number of HSP's gapped (non-prelim): 4 length of query: 60 length of database: 1,040,396,356 effective HSP length: 32 effective length of query: 28 effective length of database: 941,917,508 effective search space: 26373690224 effective search space used: 26373690224 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 87 (38.1 bits)