BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (43 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_C1P5Z7 Putative inhibitor of glucose uptake transporter... 93 3e-18 UniRef50_A4W6H4 Putative uncharacterized protein n=7 Tax=Enterob... 44 0.002 >UniRef50_C1P5Z7 Putative inhibitor of glucose uptake transporter sgrT n=11 Tax=Escherichia coli RepID=SGRT_ECOLI Length = 43 Score = 92.8 bits (229), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES Sbjct: 1 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 >UniRef50_A4W6H4 Putative uncharacterized protein n=7 Tax=Enterobacteriaceae RepID=A4W6H4_ENT38 Length = 50 Score = 43.9 bits (102), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/42 (52%), Positives = 25/42 (59%) Query: 2 RQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 RQFYQ YF AT + WL QRL MLE LMQW+ + S Sbjct: 7 RQFYQQYFLATKGVSWLARQCAEQRLKMLEELMQWEVTQTTS 48 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_C1P5Z7 Putative inhibitor of glucose uptake transporter... 63 3e-09 UniRef50_A4W6H4 Putative uncharacterized protein n=7 Tax=Enterob... 51 1e-05 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_C1P5Z7 Putative inhibitor of glucose uptake transporter sgrT n=11 Tax=Escherichia coli RepID=SGRT_ECOLI Length = 43 Score = 62.9 bits (151), Expect = 3e-09, Method: Composition-based stats. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES Sbjct: 1 MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 >UniRef50_A4W6H4 Putative uncharacterized protein n=7 Tax=Enterobacteriaceae RepID=A4W6H4_ENT38 Length = 50 Score = 50.9 bits (120), Expect = 1e-05, Method: Composition-based stats. Identities = 22/42 (52%), Positives = 25/42 (59%) Query: 2 RQFYQHYFTATAKLCWLRWLSVPQRLTMLEGLMQWDDRNSES 43 RQFYQ YF AT + WL QRL MLE LMQW+ + S Sbjct: 7 RQFYQQYFLATKGVSWLARQCAEQRLKMLEELMQWEVTQTTS 48 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.313 0.127 0.409 Lambda K H 0.267 0.0403 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 175,741,725 Number of Sequences: 3077464 Number of extensions: 3629238 Number of successful extensions: 10193 Number of sequences better than 1.0e-01: 7 Number of HSP's better than 0.1 without gapping: 5 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 10184 Number of HSP's gapped (non-prelim): 10 length of query: 43 length of database: 1,040,396,356 effective HSP length: 17 effective length of query: 26 effective length of database: 988,079,468 effective search space: 25690066168 effective search space used: 25690066168 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 87 (38.1 bits)