BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= batch____ (65 letters) Database: uniref50.fasta 3,077,464 sequences; 1,040,396,356 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value UniRef50_P41070 Protein trbD n=32 Tax=root RepID=TRBD_ECOLI 103 2e-21 UniRef50_D0ZHW9 Conjugative transfer protein n=5 Tax=Salmonella ... 84 9e-16 >UniRef50_P41070 Protein trbD n=32 Tax=root RepID=TRBD_ECOLI Length = 65 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM 60 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM Sbjct: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM 60 Query: 61 KNSEI 65 KNSEI Sbjct: 61 KNSEI 65 >UniRef50_D0ZHW9 Conjugative transfer protein n=5 Tax=Salmonella enterica RepID=D0ZHW9_SALT1 Length = 81 Score = 84.4 bits (207), Expect = 9e-16, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Query: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAV 57 MN+RN V+SVP ++V DDF+ V+SNC T+I+L ++ NF++T + Sbjct: 4 MNIRN-----VISVPDESVQDDFVKYVISNCTTKIILSGRREYNFSRQEYNFSVTGM 55 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: UniRef50_P41070 Protein trbD n=32 Tax=root RepID=TRBD_ECOLI 103 2e-21 UniRef50_D0ZHW9 Conjugative transfer protein n=5 Tax=Salmonella ... 84 9e-16 Sequences not found previously or not previously below threshold: CONVERGED! >UniRef50_P41070 Protein trbD n=32 Tax=root RepID=TRBD_ECOLI Length = 65 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM 60 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM Sbjct: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAVGVM 60 Query: 61 KNSEI 65 KNSEI Sbjct: 61 KNSEI 65 >UniRef50_D0ZHW9 Conjugative transfer protein n=5 Tax=Salmonella enterica RepID=D0ZHW9_SALT1 Length = 81 Score = 84.4 bits (207), Expect = 9e-16, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Query: 1 MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFGSESLPDNFNMTAV 57 MN+RN V+SVP ++V DDF+ V+SNC T+I+L ++ NF++T + Sbjct: 4 MNIRN-----VISVPDESVQDDFVKYVISNCTTKIILSGRREYNFSRQEYNFSVTGM 55 Database: uniref50.fasta Posted date: Mar 8, 2010 10:38 AM Number of letters in database: 1,040,396,356 Number of sequences in database: 3,077,464 Lambda K H 0.312 0.130 0.337 Lambda K H 0.267 0.0395 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 213,218,352 Number of Sequences: 3077464 Number of extensions: 5601510 Number of successful extensions: 11610 Number of sequences better than 1.0e-01: 2 Number of HSP's better than 0.1 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11606 Number of HSP's gapped (non-prelim): 4 length of query: 65 length of database: 1,040,396,356 effective HSP length: 37 effective length of query: 28 effective length of database: 926,530,188 effective search space: 25942845264 effective search space used: 25942845264 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.4 bits) S2: 87 (38.2 bits)